線上CFD交易 | 交易市場 | Plus500

  • 2022-01-07Data di raccolta
  • 2022-02-15Aggiornato
線上CFD交易 | 交易市場 | Plus500
  • Indirizzo Web:www.plus500.com
  • IP del server:152.195.55.222
  • Descrizione del sito:英國、德國和西班牙最大的CFD供應商。交易全球最熱門的市場:外匯、加密數位貨幣、股票、商品、指數、ETF和期權的CFD。

nome del dominio:www.plus500.comValutazione

di 5000~500000

nome del dominio:www.plus500.comflusso

40

nome del dominio:www.plus500.comBene o male

Senza saggezza. difficile riuscire feroce

sito web:線上CFD交易 | 交易市場 | Plus500Pesi

3

sito web:線上CFD交易 | 交易市場 | Plus500IP

152.195.55.222

sito web:線上CFD交易 | 交易市場 | Plus500soddisfare

OnlineCFDTrading|TradingtheMarkets|Plus500functiondeleteCookie(name,domain,path){document.cookie=name+"=;expires=Thu,01Jan197000:00:00GMT;path="+path+";domain="+domain;}functiondisableGoogleAnalytics(disable){window['ga-disable-UA--19']=disable;if(disable){varcookiesDomain="localhost";if(window.location.host.lastIndexOf("localhost",0)!==0){cookiesDomain="."+window.location.host.split(".").slice(1).join(".");}deleteCookie("_ga",cookiesDomain,'/')deleteCookie("_gid",cookiesDomain,'/')deleteCookie("_gat_UA--19",cookiesDomain,'/')}}if(window.localStore["Disable3rdPartyAnalytics"]==="true"){disableGoogleAnalytics(true)}window.dataLayer=window.dataLayer||[];window.dataLayer.push({'customPePath':'/','urlCountry':'GB','langue':'en','IsInAppView':'false'});(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':newDate().getTime(),event:'gtm.js'});varf=d.getElementsByTName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-RQS5');Plus500doesnotprovideCFDservicestoresidentsofUnitedStates.Plus500doesnotprovideCFDservicestoresidentsofUnitedStates.73%ofretailCFDaccountslosemoney.Plus500logoinsidehomepelinkMarketsBackIndicesForexCommoditiesSharesOptionsETFsAllInstrumentsTradingBackPremiumServiceProfessionalTradingFees&ChargesEducation&InsightsTradingAcademyEconomicCalendarRiskManementAlertsNews&MarketInsightsCompanyBackAboutUsAffiliatesInvestorRelationsCookiesandPrivacySponsorshipsLegiaWarsawSponsorshipAtalantaB.C.SponsorshipBSCYoungBoysSponsorshipLoginenBackČeskyDanskDeutschEestiEspa241;olEλληνικάFran231;aisHrvatski237;slenskaItalianoLatviešuLietuviškaiMyarNederlandsNorskPolskiPortugu234;sPyccĸийRom226;năSlovenčinaSlovenskiSuomeksiSvenskaT252;rk231;eбългарскиעבריתالعربية简体中文繁體中文MenuStartTradingSearch{{toCategoryName(category)}}Trade{{r.name}}TradeNoresultsfound...ContactUsIT'STRADINGwithaPlusCFDsonSharesIndicesForexCommoditiesStartTradingNowTryFreeDemoJoinover22milliontradersworldwid線上CFD交易 | 交易市場 | Plus500ewhohealreadychosenPlus500Sinceinception$800+BillionTradedValue2800*Instruments22+MillionRegisteredCustomers300+MillionPositionsOpened50+Countries*Instrumentailabilityissubjecttojurisdiction.AworldofopportunitieswithGlobalMarketsDiscoverthousandsofCFDsontheworld’smostpopularfinancialinstrumentsandgetfreereal-timequotestoexploreendlesstradingopportunities.{{activeCategoryName}}{{instrument.name}}{{instrument.price?instrument.price.toFixed(instrument.precision):'--'}}{{instrument.changeRate.toFixed(percentPrecision)}}%TradevarfeedApp;varinitialData={"MostPopular":{"categoryName":"MostPopular","instruments":[{"instrumentId":4,"precision":5,"threshold":"0.5","name":"GBP/USD","instrumentLink":"/en/Instruments/GBPUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.51},{"instrumentId":28,"precision":3,"threshold":"0.5","name":"GBP/JPY","instrumentLink":"/en/Instruments/GBPJPY","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":163.642,"changeRate":-0.98},{"instrumentId":10,"precision":2,"threshold":"2.0","name":"Oil","instrumentLink":"/en/Instruments/CL","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":108.41,"changeRate":2.53},{"instrumentId":123,"precision":3,"threshold":"2.0","name":"NaturalGas","instrumentLink":"/en/Instruments/NG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":5.617,"changeRate":3.62},{"instrumentId":11,"precision":2,"threshold":"2.0","name":"Gold","instrumentLink":"/en/Instruments/XAU","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1810.71,"changeRate":0.23},{"instrumentId":4078,"precision":2,"threshold":"1.0","name":"US-TECH100","instrumentLink":"/en/Instruments/NQ","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.18,"changeRate":0.73},{"instrumentId":7814,"precision":2,"threshold":"1.0","name":"NFTGiantsIndex","instrumentLink":"/en/Instruments/BNFTGI","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":706.26,"changeRate":-0.73},{"instru線上CFD交易 | 交易市場 | Plus500mentId":3869,"precision":2,"threshold":"1.0","name":"UK100","instrumentLink":"/en/Instruments/UK100","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":7179.25,"changeRate":0.83}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-mostpopular.svg"},"Stocks":{"categoryName":"Shares","instruments":[{"instrumentId":4674,"precision":2,"threshold":"4.0","name":"NIO(WeeklyContract)","instrumentLink":"/en/Instruments/NIO_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":21.33,"changeRate":-1.66},{"instrumentId":4683,"precision":2,"threshold":"4.0","name":"BYD(WeeklyContract)","instrumentLink":"/en/Instruments/1211_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":313.65,"changeRate":-0.06},{"instrumentId":4680,"precision":2,"threshold":"4.0","name":"Moderna(WeeklyContract)","instrumentLink":"/en/Instruments/MRNA_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":149.54,"changeRate":4.97},{"instrumentId":4681,"precision":2,"threshold":"4.0","name":"NikolaCorporation(WeeklyContract)","instrumentLink":"/en/Instruments/NKLA_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":4.71,"changeRate":-0.84},{"instrumentId":4675,"precision":2,"threshold":"4.0","name":"PalantirTechnologies(WeeklyContract)","instrumentLink":"/en/Instruments/PLTR_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":9.25,"changeRate":2.21},{"instrumentId":4678,"precision":2,"threshold":"4.0","name":"Pfizer(WeeklyContract)","instrumentLink":"/en/Instruments/PFE_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":52.21,"changeRate":-0.49},{"instrumentId":4682,"precision":2,"threshold":"4.0","name":"Alibaba(WeeklyContract)","instrumentLink":"/en/Instruments/BABA_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":115.91,"changeRate":2.01},{"instrumentId":4684,"precision":2,"threshold":"4.0","name":"AstraZeneca(UK)-WeeklyContract","instrumentLink":"/en/Instruments/AZN_W","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.86,"changeRate":-0.65}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-stocks.svg"},"Commodities":{"categoryName":"Commodities","instruments":[{"instrumentId":10,"precision":2,"threshold":"2.0","name":"Oil","instrumentLink":"/en/Instruments/CL","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":108.41,"changeRate":2.53},{"instrumentId":431,"precision":2,"threshold":"2.0","name":"BrentOil","instrumentLink":"/en/Instruments/EB","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":111.48,"changeRate":2.31},{"instrumentId":430,"precision":4,"threshold":"2.0","name":"HeatingOil","instrumentLink":"/en/Instruments/HO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3.9500,"changeRate":2.83},{"instrumentId":11,"precision":2,"threshold":"2.0","name":"Gold","instrumentLink":"/en/Instruments/XAU","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1810.71,"changeRate":0.23},{"instrumentId":12,"precision":3,"threshold":"2.0","name":"Silver","instrumentLink":"/en/Instruments/X","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":19.838,"changeRate":-1.99},{"instrumentId":4092,"precision":2,"threshold":"2.0","name":"LowSulphurGasoil","instrumentLink":"/en/Instruments/G","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1217.00,"changeRate":5.23},{"instrumentId":115,"precision":2,"threshold":"2.0","name":"Coffee","instrumentLink":"/en/Instruments/KC","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":223.82,"changeRate":-2.69},{"instrumentId":1461,"precision":2,"threshold":"2.0","name":"Palladium","instrumentLink":"/en/Instruments/PA","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1930.88,"changeRate":1.06}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-commodities.svg"},"Indices":{"categoryName":"Indices","instruments":[{"instrumentId":3869,"precision":2,"threshold":"1.0","name":"UK100","instrumentLink":"/en/Instruments/UK100","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":7179.25,"changeRate":0.83},{"instrumentId":98,"precision":0,"threshold":"1.0","name":"ASX200","instrumentLink":"/en/Instruments/SPI200","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":6545.0,"changeRate":1.49},{"instrumentId":3017,"precision":2,"threshold":"1.0","name":"Germany40","instrumentLink":"/en/Instruments/FDAX","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.99,"changeRate":0.07},{"instrumentId":4173,"precision":0,"threshold":"1.0","name":"Spain35","instrumentLink":"/en/Instruments/IBX","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":8179.0,"changeRate":1.74},{"instrumentId":85,"precision":0,"threshold":"1.0","name":"USA30-WallStreet","instrumentLink":"/en/Instruments/YM","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.0,"changeRate":0.91},{"instrumentId":4310,"precision":2,"threshold":"1.0","name":"Netherlands25","instrumentLink":"/en/Instruments/FT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":661.08,"changeRate":-0.54},{"instrumentId":18,"precision":2,"threshold":"1.0","name":"USA500","instrumentLink":"/en/Instruments/ES","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3825.28,"changeRate":0.95},{"instrumentId":295,"precision":0,"threshold":"1.0","name":"Italy40","instrumentLink":"/en/Instruments/FIBi","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.0,"changeRate":1.16}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-indices.svg"},"Forex":{"categoryName":"Forex","instruments":[{"instrumentId":2,"precision":5,"threshold":"0.5","name":"EUR/USD","instrumentLink":"/en/Instruments/EURUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.48},{"instrumentId":5,"precision":5,"threshold":"0.5","name":"EUR/GBP","instrumentLink":"/en/Instruments/EURGBP","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":0.13},{"instrumentId":177,"precision":5,"threshold":"0.5","name":"EUR/AUD","instrumentLink":"/en/Instruments/EURAUD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.76},{"instrumentId":376,"precision":5,"threshold":"0.5","name":"EUR/NZD","instrumentLink":"/en/Instruments/EURNZD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.04},{"instrumentId":72,"precision":4,"threshold":"0.5","name":"EUR/CAD","instrumentLink":"/en/Instruments/EURCAD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.3439,"changeRate":-0.39},{"instrumentId":100,"precision":4,"threshold":"0.5","name":"EUR/CHF","instrumentLink":"/en/Instruments/EURCHF","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.0008,"changeRate":-0.01},{"instrumentId":4,"precision":5,"threshold":"0.5","name":"GBP/USD","instrumentLink":"/en/Instruments/GBPUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.51},{"instrumentId":39,"precision":5,"threshold":"0.5","name":"AUD/USD","instrumentLink":"/en/Instruments/AUDUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":-1.23}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-forex.svg"},"Options":{"categoryName":"Options","instruments":[{"instrumentId":,"precision":2,"threshold":"40.0","name":"Meta|Call185","instrumentLink":"/en/Instruments/METAJUL22C185","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.45,"changeRate":-39.61},{"instrumentId":,"precision":2,"threshold":"40.0","name":"NASDAQ100|Put","instrumentLink":"/en/Instruments/NQJUL22P","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":203.06,"changeRate":-26.48},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Tesla|Put620","instrumentLink":"/en/Instruments/TSLAJUL22P620","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":15.69,"changeRate":-20.1},{"instrumentId":,"precision":5,"threshold":"40.0","name":"EUR/USD|Put1.035","instrumentLink":"/en/Instruments/EURUSDJUL22P1.035","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":105.63},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Amazon|Put104","instrumentLink":"/en/Instruments/AMAZONJUL22P104","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.70,"changeRate":-46.91},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Europe50|Call3650","instrumentLink":"/en/Instruments/OESXJUL22C3650","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":6.60,"changeRate":-34.95},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Apple|Put125","instrumentLink":"/en/Instruments/AAPLJUL22P125","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.49,"changeRate":-39.29},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Oil|Call112","instrumentLink":"/en/Instruments/CLAUG22C112","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":2.50,"changeRate":40.44}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-options.svg"},"ETFs":{"categoryName":"ETFs","instruments":[{"instrumentId":145,"precision":2,"threshold":"3.0","name":"USO-OilFund","instrumentLink":"/en/Instruments/USO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":81.62,"changeRate":1.66},{"instrumentId":403,"precision":2,"threshold":"3.0","name":"iSharesSilver","instrumentLink":"/en/Instruments/SLV","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":18.30,"changeRate":-1.72},{"instrumentId":148,"precision":2,"threshold":"3.0","name":"UNG-GasFund","instrumentLink":"/en/Instruments/UNG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":19.28,"changeRate":1.58},{"instrumentId":150,"precision":2,"threshold":"3.0","name":"OIH-OilService","instrumentLink":"/en/Instruments/OIH","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":231.20,"changeRate":-0.42},{"instrumentId":144,"precision":2,"threshold":"3.0","name":"GLDGold","instrumentLink":"/en/Instruments/GLD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":168.19,"changeRate":-0.12},{"instrumentId":1349,"precision":2,"threshold":"3.0","name":"CommodityIndexFund","instrumentLink":"/en/Instruments/DBC","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":26.74,"changeRate":0.45},{"instrumentId":3519,"precision":2,"threshold":"3.0","name":"GlobalXLithium&BatteryTech","instrumentLink":"/en/Instruments/LIT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":71.69,"changeRate":-1.14},{"instrumentId":4202,"precision":2,"threshold":"3.0","name":"NUGT","instrumentLink":"/en/Instruments/NUGT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":36.14,"changeRate":5.56}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-etfs.svg"},"RisersAndFallers":{"categoryName":"Risers&Fallers","instruments":[{"instrumentId":,"precision":5,"threshold":"40.0","name":"EUR/USD|Put1.035","instrumentLink":"/en/Instruments/EURUSDJUL22P1.035","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":105.63},{"instrumentId":4956,"precision":2,"threshold":"4.0","name":"Coupang","instrumentLink":"/en/Instruments/CPNG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":14.94,"changeRate":17.76},{"instrumentId":4092,"precision":2,"threshold":"2.0","name":"LowSulphurGasoil","instrumentLink":"/en/Instruments/G","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1217.00,"changeRate":5.23},{"instrumentId":3224,"precision":4,"threshold":"2.0","name":"Gasoline","instrumentLink":"/en/Instruments/RB","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3.6685,"changeRate":4.28},{"instrumentId":,"precision":5,"threshold":"40.0","name":"EUR/USD|Call1.07","instrumentLink":"/en/Instruments/EURUSDJUL22C1.07","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":-80.41},{"instrumentId":1697,"precision":2,"threshold":"4.0","name":"Kohl's","instrumentLink":"/en/Instruments/KSS","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":28.60,"changeRate":-19.64},{"instrumentId":4064,"precision":2,"threshold":"2.0","name":"EUA","instrumentLink":"/en/Instruments/ECF","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":86.06,"changeRate":-4.51},{"instrumentId":3094,"precision":2,"threshold":"2.0","name":"Wheat","instrumentLink":"/en/Instruments/ZW","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":840.28,"changeRate":-4.3}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-risers-fallers.svg"}}window.addEventListener('load',function(){varoptions={rootElement:'#feedTable',initialData:initialData,apiUrl:'/en/api/LiveData/FeedsUpdates',priceDownClass:'red',priceUpClass:'green',percentUpClass:'inst-up',percentDownClass:'inst-down',thresholdClass:"highlight-threshold",updateInterval:2500,percentPrecision:2}if("IntersectionObserver"inwindow){varobserver=newwindow.IntersectionObserver(function(entries){varentry=entries[0]if(entry.isIntersecting){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/feedsApp.min.js",document.body,function(){feedApp=initFeedsApp(options)});})observer.unobserve(entry.target);}},{threshold:0.05,rootMargin:'20%'});observer.observe(document.querySelector(options.rootElement))}else{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/feedsApp.min.js",document.body,function(){feedApp=initFeedsApp(options)});})}});FastandreliableorderexecutionNocommissionsandtightspreadsAdvancedanalyticaltoolsLevereofupto1:30Real-timequotesFastandsecurewithdrawalsExploreMarketsMarketNewsProtected&secureYourdataissafeandyourfundsarekeptinsegregatedbankaccounts,inaccordancewithregulatoryrequirements.ProfessionalsupportGetaround-the-clockdedicatedcustomerserviceinmultiplelangues.RegulatedLicensedandregulatedbyavarietyofgloballeadingregulators.Learnmore.ReliablePlus500LtdisaFTSE250companylistedontheLondonStockExchange’sMainMarketforListedCompanies.*Plus500offersmultipleglobalpaymentmethods.InvestinginyourfouritestocksLearnmoreLeveredtrading,goinglongorshortStartTradingNowTradingthemostpopularU.S.Futures*ailableonlyintheU.S.TradeCFDsonPopularSharesBuyorSellCFDsonSharessuchasApple,Amazon,Tesla,andotherworld-leadingStockswithourinnovativetradingplatform.TradeSharesTradeCFDsonavarietyofCommoditiesBuyorSellCFDsonCommoditiessuchasOil,Gold,Silver,andothercommoditiesusingouradvancedtechnology.TradeCommoditiesTradeCFDsonyourfouriteForexpairsBuyorSellCFDsonForexpairssuchasEUR/USD,GBP/USD,EUR/GBP,andmoreusingoureconomiccalendartokeepuptodateonglobalevents.TradeForexTradeCFDsonIndicesfromaroundtheglobeBuyorSellCFDsonIndicessuchasS&P500(ES),NASDAQ100(NQ),FTSE100(UK100),andotherpopularindicesusingourfreereal-timequotes.TradeIndicesTradeSmarterPracticeyourstrategyTryourfreedemoaccountbeforeyouopenarealtradingaccounttoexploreourintuitivetradingplatformandenhanceyourskills.TrynowExpandyourknowledgeLearnabouttradingCFDswithPlus500usingourcomprehensiveeducationalmaterials.EnterTradingAcademyManeyourriskUseouradvancedriskmanementtoolstolimityourlossesandlockinprofits.ReadmoreWeSponsorATALANTAB.C.LEGIAWARSAWBSCYOUNGBOYSwindow.addEventListener('load',()=>{if("IntersectionObserver"inwindow){letoptions={threshold:0.5}letobserverCallback=function(entries){entries.filter(e=>e.isIntersecting).forEach(entry=>{letsectionName=entry.target.dataset.sectionName;sendAnalyticsEvent("HomepeSection","SectionVisible",sectionName)observer.unobserve(entry.target)})}letelements=document.querySelectorAll('section[data-section-name]');letobserver=newIntersectionObserver(observerCallback,options)elements.forEach(el=>observer.observe(el));}document.querySelectorAll("a[data-cta-name]").forEach(el=>{el.addEventListener('click',()=>{letctaName=el.dataset.ctaName;letsection=el.closest("section[data-section-name]")letsectionName=section?section.dataset.sectionName:"";sendAnalyticsEvent("HomepeCTAClick",ctaName,sectionName)});})letrtl=false;ScrollTrigger.matchMedia({"(min-width:1024px)":function(){//PlusAnimationletplusesTarget=document.querySelectorAll(".gs-anim-target")plusesTarget.forEach((element)=>{letplus=element.querySelectorAll(".plus-bg-small,.plus-bg-medium,.plus-bg-large"),tl=gsap.timeline().from(plus,{yPercent:150,duration:1,stger:.2,ease:"slow"})ScrollTrigger.create({trigger:element,start:"050%",end:"100%50%",animation:tl,scrub:.5})})//TableWidgetAnimationgsap.timeline({scrollTrigger:{trigger:".gs-regulatory-widget",start:"-30%50%",end:"50%50%",once:true,}}).from(".gs-regulatory-widget",{opacity:0,xPercent:rtl?"-50":"50"});//IpadAnimationgsap.timeline({scrollTrigger:{trigger:".gs-trading-img-box",start:"-20%50%",end:"050%"}}).from(".gs-trading-img-box",{opacity:0,xPercent:100,duration:.5});//SponsorAnimationgsap.timeline({scrollTrigger:{trigger:".sponsorships-section",start:'20%50%',end:'70%50%',}}).from(".sponsorships-item:last-child",{xPercent:rtl?"40":"-40",duration:.5}).from(".sponsorships-item:nth-last-child(2)",{xPercent:rtl?"-40":"40",duration:.5},"=-.5");},"all":function(){//IconsAnimationleticonsTarget=document.querySelectorAll(".items-icon-group")iconsTarget.forEach((element)=>{leticon=element.querySelectorAll(".item-icon"),tl=gsap.timeline().from(icon,{opacity:0,scale:0,duration:.5,stger:.1})ScrollTrigger.create({trigger:element,start:"-40%50%",end:"60%50%",animation:tl})})//IphoneAnimationgsap.timeline({scrollTrigger:{trigger:".gs-payment-section",start:"-25%50%",end:"10%50%"}}).from(".gs-payment-header-bg",{opacity:0,y:400,duration:.5});}});})NeedHelp?24/7SupportAboutUsNews&MarketInsightsClientMoneyProtectionRiskDisclosureNoticeTerms&reementsModernSleryStatementCookiePolicyCFDsarecomplexinstrumentsandcomewithahighriskoflosingmoneyrapidlyduetolevere.73%ofretailinvestoraccountslosemoneywhentradingCFDswiththisprovider.YoushouldconsiderwhetheryouunderstandhowCFDsworkandwhetheryoucanaffordtotakethehighriskoflosingyourmoney.Plus500ismainlycompensatedforitsservicesthroughtheBid/Askspread. CheckourFees&Charges.Theinformationonthiswebsiteisgeneralinnature.Pleaseconsidertheinformationinlightofyourobjectives,financialsituationandneeds.Plus500isatrademarkofPlus500Ltd.Plus500Ltdoperatesthroughthefollowingsubsidiaries:Plus500UKLtdisauthorisedandregulatedbytheFinancialConductAuthority(FRN ).CryptocurrencyCFDsarenotailabletoRetailClients.OfficeAddress:Plus500UKLtd,8AngelCourt,Copthallenue|LondonEC2R7HJ.Plus500CYLtdisauthorisedandregulatedbytheCyprusSecuritiesandExchangeCommission(Licence No. 250/14).CryptocurrencyCFDsarenotailabletoUKRetailClients.Plus500AUPtyLtdholdsAFSL #issuedbyASIC,FSPNo. issuedbytheFMAinNewZealandandAuthorisedFinancialServicesProvider #issuedbytheFSCAinSouthAfrica.Plus500SEYLtdisauthorisedandregulatedbytheSeychellesFinancialServicesAuthority(Licence No. SD039).Plus500EEASisauthorisedandregulatedbytheEstonianFinancialSupervisionandResolutionAuthority(LicenceNo. 4.1-1/18).Plus500SGPteLtd(UEN1Z)holdsacapitalmarketsserviceslicensefromtheMonetaryAuthorityofSingaporefordealingincapitalmarketsproducts(LicenseNo.CMS-1).Plus500ProSecuredBySSL. ©Plus500.Allrightsreserved.FollowUsOn:FacebookTwitterInstram24/7SupportPlus500usescookiestoimproveyourbrowsingexperience.Youcanclickacceptorcontinuebrowsingtoconsenttocookiesuse.ReadourCookiePolicytolearnmore.Acceptwindow.addEventListener("load",function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/foundation.min.js",document.body,function(){$(document).foundation();$(document).on("reInitFoundation",function(e){$(document).foundation();});});});window.addEventListener('load',()=>{gsap.registerPlugin(SplitText);consttargetSlogans=document.querySelectorAll('.main-banner-anim-item'),splitTextTimeline=newTimelineMax({repeat:-1});targetSlogans.forEach(targetSlogan=>{gsap.set(targetSlogan,{perspective:300});constisArabic=(document.documentElement.lang==="ar");letsplitType=isArabic?"words":"chars,words"letmySplitText=newSplitText(targetSlogan,{type:splitType,charsClass:"char"});letanimationType=isArabic?mySplitText.words:mySplitText.chars;splitTextTimeline.set(targetSlogan,{autoAlpha:1,display:"block"});splitTextTimeline.from(animationType,{duration:.4,rotationX:90,transformOrigin:"50%50%",ease:"ease",stger:0.04});splitTextTimeline.set(targetSlogan,{autoAlpha:0,display:"none",delay:1.5});});constmainBanner=document.querySelector(".main-banner"),buttonBanner=mainBanner.querySelector(".banner-link-button"),buttonClose=mainBanner.querySelector(".close");if(buttonBanner!=null){buttonBanner.addEventListener('click',()=>{if(mainBanner.classList.contains('hero-banner')){mainBanner.classList.remove('hero-banner');mainBanner.classList.add('marketing-banner');}else{mainBanner.classList.remove('marketing-banner');mainBanner.classList.add('hero-banner');}});}if(buttonClose!==undefined){buttonClose.addEventListener('click',()=>{mainBanner.classList.remove('marketing-banner');mainBanner.classList.add('hero-banner');});}});functionresizeHeroSection(){conststickyFooter=document.querySelector('.sticky-footer-wrapper'),mainHeader=document.querySelector('.main-header');letstickyFooterHeight=(typeof(stickyFooter)!=='undefined'&&stickyFooter!==null)?stickyFooter.offsetHeight:0,mainHeaderHeight=(typeof(mainHeader)!=='undefined'&&mainHeader!==null)?mainHeader.offsetHeight:0,calculatedHeight=stickyFooterHeight+mainHeaderHeight,composerVH=(typeof(visualViewport)!=='undefined')?window.visualViewport.height:window.innerHeight,doc=document.documentElement;doc.style.setProperty("--composer-vh",(composerVH-calculatedHeight)+"px");}window.addEventListener('load',()=>{resizeHeroSection();if(typeofwindow.visualViewport!=='undefined'){window.visualViewport.addEventListener("resize",resizeHeroSection);}else{window.addEventListener("resize",resizeHeroSection);}});window.addEventListener('load',(event)=>{vartl1=newTimelineMax({onComplete:function(){this.restart();}});tl1.fromTo(".item-anim1,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0}).to(".item-anim1,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim2,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim2,.item-anim5",.5,{opacity:0,x:-50},"+=3").fromTo(".item-anim3,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0},"-=.3").to(".item-anim3,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim1,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim1,.item-anim5",.5,{opacity:0,x:-50},"+=3").fromTo(".item-anim2,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0},"-=.3").to(".item-anim2,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim3,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim3,.item-anim5",.5,{opacity:0,x:-50},"+=3")});window.addEventListener("load",function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/slick.min.js",document.body,function(){functionlazyLoadSlideBackgroundIme(backgroundImeWrapper){if(backgroundImeWrapper===null)return;if(backgroundImeWrapper.hasAttribute("data-background-ime")){backgroundImeWrapper.style.backgroundIme=`url(${backgroundImeWrapper.dataset.backgroundIme})`;backgroundImeWrapper.removeAttribute("data-background-ime");}}constseoSliderElem=$('#seoSlider');seoSliderElem.slick({arrows:false,centerMode:true,centerPadding:0,dots:true,infinite:false,speed:1000,rtl:false,slidesToScroll:1,slidesToShow:1,mobileFirst:true,responsive:[{breakpoint:1023,settings:{centerPadding:"5%",}},{breakpoint:1439,settings:{centerPadding:"20%",}},{breakpoint:2559,settings:{centerPadding:"30%",}},{breakpoint:3839,settings:{centerPadding:"35%",}}],});constseoSection=document.querySelector('[data-section-name="seo-carousel"]');constseoSliderElementsLength=seoSliderElem[0].slick.$slides.length;constseoSectionObserver=newIntersectionObserver((entries)=>{constcurrentSlide=seoSliderElem[0].slick.currentSlide;if(entries[0].isIntersecting){if(seoSliderElementsLength>0){lazyLoadSlideBackgroundIme(seoSliderElem[0].slick.$slides[currentSlide].querySelector("[data-background-ime]"));lazyLoadSlideBackgroundIme(seoSliderElem[0].slick.$slides[currentSlide+1].querySelector("[data-background-ime]"));}if(currentSlide===0){seoSliderElem.slick('sl線上CFD交易 | 交易市場 | Plus500ickGoTo',currentSlide+1);}if(currentSlide>0){seoSliderElem.slick('slickGoTo',currentSlide-1);}}});seoSectionObserver.observe(seoSection);seoSliderElem.on("beforeChange",(event,slick,currentSlide,nextSlide)=>{if((nextSlide+1){constloadGlobalSearchJsFile=()=>{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/globalSearch.min.js",document.body,function(){searchApp=initSearch(searchOptions);searchElem=newFoundation.Dropdown($(searchOptions.rootElement),{parentClass:"header-search-wrapper",closeOnClick:"true",position:"bottom",alignment:"right"});searchElem.$element.on("hide.zf.dropdown",()=>{searchButton.classList.remove("is-open");});});};loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,loadGlobalSearchJsFile);searchButton.removeEventListener("mouseover",loadAndInitGlobalSearch);searchButton.removeEventListener("touchstart",loadAndInitGlobalSearch);};window.addEventListener("load",()=>{constmobileMenuTrigger=document.querySelector(".mobile-menu-trigger");constmainMenu=document.querySelector(".main-menu>ul");if(searchButton){searchButton.addEventListener("mouseover",loadAndInitGlobalSearch);searchButton.addEventListener("touchstart",loadAndInitGlobalSearch);searchButton.addEventListener("click",(e)=>{e.currentTarget.classList.toggle("is-open");mobileMenuTrigger.classList.remove("is-open");mainMenu.dataset.height='0';mainMenu.style.height=0;mainMenu.classList.remove("open","drill-down");if(mainMenu.classList.contains("open")){mainMenu.classList.remove("open");}});}mobileMenuTrigger.addEventListener("click",(e)=>{e.currentTarget.classList.toggle("is-open");if(searchElem){searchElem.$element.foundation("close");}});varheaderTradingItem=document.querySelector(".start-trading-link");if(headerTradingItem!=null){headerTradingItem.addEventListener('click',function(){sendAnalyticsEvent("NewHeaderClick","StartTrading");});}document.querySelectorAll(".main-menua[data-pe]").forEach(el=>{el.addEventListener('click',()=>{letpeName=el.dataset.pe;letmenuCategory=el.closest("ul").dataset.menuName;sendAnalyticsEvent("HeaderMenuClick",menuCategory,peName);});});document.querySelector(".main-menu").addEventListener("mouseover",(e)=>{if(e.target.getAttribute("aria-haspopup")&&searchButton.classList.contains("is-open")){searchElem.$element.foundation("close");}});});window.addEventListener("DOMContentLoaded",()=>{constrwContainer=document.querySelector(".rw-container");constmainHeader=document.querySelector(".main-header");functionstickyRiskWarningHeight(init){mainHeader.classList.remove("rw-collapsed","rw-collapsible");mainHeader.classList.add(init?"rw-collapsed":"rw-collapsible");resizeHeroSection();}rwContainer.addEventListener("click",(e)=>{if(e.currentTarget.closest('.rw-collapsed')){KeyValueStore.remove("_uk_riskwarning_hidden_");stickyRiskWarningHeight(false);}else{KeyValueStore.set("_uk_riskwarning_hidden_",true);stickyRiskWarningHeight(true);}});//Init-Checkrwcookiestatus//TODO:bindthestatetotheclassandbuttontooidlayoutshiftif(KeyValueStore.get("_uk_riskwarning_hidden_",false)==null){stickyRiskWarningHeight(false);}else{stickyRiskWarningHeight(true);}});window.addEventListener('load',()=>{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/support-button-on-scroll.min.js",document.body,()=>{initializeSupportButton();});});document.addEventListener("DOMContentLoaded",()=>{constcookieBannerWrapper=document.querySelector(".sticky-cookie-wrapper");if(localStore.getItem("_cookies_use_")){cookieBannerWrapper.remove();}else{cookieBannerWrapper.classList.remove("hide");}loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/user-cookies-maner.js",document.body,()=>{cookieBannerWrapper.querySelector("#cookie-banner-accept-button").addEventListener('click',()=>{UserCookiesManer.onCookiesBannerAccept()cookieBannerWrapper.classList.add("cookie-out");cookieBannerWrapper.addEventListener("transitionend",()=>{if(typeofresizeHeroSection==="function")resizeHeroSection();cookieBannerWrapper.remove();});});if(!UserCookiesManer.isAcceptedCookies()){sendAnalyticsEvent('UserCookies','ShowBannerUnique')}})});functioncheckGaLoaded(){if(typeofga==='function'){}else{setTimeout(checkGaLoaded,500);}}checkGaLoaded();$(function(){varlazyImes=document.querySelectorAll("img.lazyload");if('loading'inHTMLImeElement.prototype){lazyImes.forEach(function(elem){elem.classList.remove("lazyload");if(elem.dataset.src){elem.removeAttribute("data-src");}if(elem.dataset.srcset){elem.removeAttribute("data-srcset");}});}else{$.each(lazyImes,function(i,el){//IE11dosen'tsupportforEach,usejQueryalternativeif(el.src){el.removeAttribute("src");}if(el.srcset){el.removeAttribute("srcset");}});//lazyImes.forEach(function(elem){//if(elem.src){elem.removeAttribute("src");}//if(elem.srcset){elem.removeAttribute("srcset");}//});}loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/lazysizes.min.js",document.body)});

Posto:線上CFD交易 | 交易市場 | Plus500rapporto

In caso di violazione del sito, fare clic su Segnalarapporto

Informazioni consigliate

Sito consigliato