OLX Pusatnya Nge-Deal

  • 2022-01-06Data di raccolta
  • 2022-02-15Aggiornato
OLX Pusatnya Nge-Deal
  • Indirizzo Web:www.olx.co.id
  • IP del server:23.35.26.138
  • Descrizione del sito:OLX Indonesia, pusat jual beli online terbesar di Indonesia. Semua barang ada disini, dari handphone, komputer, otomotif, fashion bahkan rumah dan lowongan kerja.

nome del dominio:www.olx.co.idValutazione

di 5000~500000

nome del dominio:www.olx.co.idflusso

116

nome del dominio:www.olx.co.idBene o male

Il futuro è luminoso. piccola speranza feroce

sito web:OLX Pusatnya Nge-DealPesi

4

sito web:OLX Pusatnya Nge-DealIP

23.35.26.138

sito web:OLX Pusatnya Nge-Dealsoddisfare

OLXPusatnyaNge-DealfunctiontrackAbandonment(){document.removeEventListener('visibilitychange',trackAbandonment);varHYDRA_URL='tracking.olx-st.com/h/p-olx-abandon';varevent=["abandon_time="+Math.round(performance.now()),"device=desktop","host="+encodeURIComponent(location.hostname),"path="+encodeURIComponent(location.pathname),"referrer="+encodeURIComponent(document.referrer)].join('&');vardata=JSON.stringify({tracks:[event]});varsent=nigator.sendBeacon&&nigator.sendBeacon(HYDRA_URL,data);};document.addEventListener('visibilitychange',trackAbandonment);window.addEventListener('load',function(event){document.removeEventListener('visibilitychange',trackAbandonment);});!function(n,e){vart,o,i,c=[],f={passive:!0,capture:!0},r=newDate,a="pointerup",u="pointercancel";functionp(n,c){t||(t=c,o=n,i=newDate,w(e),s())}functions(){o>=0&&o1e12?newDate:performance.now())-t.timeStamp;"pointerdown"==t.type?function(t,o){functioni(){p(t,o),r()}functionc(){r()}functionr(){e(a,i,f),e(u,c,f)}n(a,i,f),n(u,c,f)}(o,t):p(o,t)}}functionw(n){["click","mousedown","keydown","touchstart","pointerdown"].forEach(function(e){n(e,l,f)})}w(n),self.perfMetrics=self.perfMetrics||{},self.perfMetrics.onFirstInputDelay=function(n){c.push(n),s()}}(addEventListener,removeEventListener);perfMetrics.onFirstInputDelay(function(delay,event){window.fid={delay:delay,event:event}});.rui-1sUjK{color:#fff;bottom:0;left:0;text-align:center;background:#002f34;width:100%;z-index:1000}.rui-1sUjK.rui-RyThX{padding:16px}.rui-21NnR{height:3px;width:100%;position:fixed;top:0;z-index:20;overflow:hidden;background-color:#7f9799}.rui-21NnR:before{display:block;position:absolute;content:"";left:-200px;width:200px;height:3px;background-color:#002f34;animation:loading2slinearinfinite}@keyframesloading{0%{left:-200px;width:30%}50%{width:30%}70%{width:70%}80%{left:50%}95%{left:120%}to{left:100%}}.rui-10VVT{top:0;left:0;right:0;bottom:0;width:100%;z-index:11;height:100%;display:table;position:fixed;text-align:center;background:rgba(0,0,0,.8)}.rui-10VVT.rui-2yNXV{margin:0auto;display:table-cell;vertical-align:middle}.rui-10VVT.rui-2yNXVcircle{stroke:#fff}.rui-10VVT.rui-2yNXVp{font-weight:500;margin:15px00;font-size:16px;color:#fff}.rui-9iIWV{animation:rotate2slinearinfinite}.rui-9iIWV.rui-1Iei9{stroke-dashoffset:0;stroke-linecap:round;stroke-dasharray:1,150;animation:dash1.5sease-in-outinfinite}@keyframesrotate{to{transform:rotate(1turn)}}@keyframesdash{0%{stroke-dashoffset:0;stroke-dasharray:1,150}50%{stroke-dashoffset:-35;stroke-dasharray:90,150}to{stroke-dashoffset:-124;stroke-dasharray:90,150}}.rui-3edbr{position:fixed;top:0;left:0;right:0;bottom:0;z-index:10;display:flex;align-items:center;justify-content:center;background:rgba(0,0,0,.8);transform:translateZ(0);-webkit-transform:translateZ(0)}.rui-3edbr.rui-2E8XD{visibility:hidden;transition:visibility.25scubic-bezier(.17,.04,.03,.94)}.rui-3edbr.rui-1YlLM{visibility:visible}body.rui-10Vyl{overflow:hidden}.rui-39-wj{display:inline-flex;justify-content:center;align-items:center;box-sizing:border-box;border-style:none;background:none;outline:none;text-transform:lowercase;font-weight:700;cursor:pointer;padding:012px;position:relative;overflow:hidden;line-height:normal;text-decoration:none}.rui-39-wj:first-letter,.rui-39-wj:first-letter{text-transform:uppercase}.rui-39-wj.rui-1JPTg{font-size:16px;height:48px}.rui-39-wj.rui-2K0j9{font-size:14px;height:40px}.rui-39-wj.rui-3Y4ih{font-size:12px;height:36px}.rui-39-wj.rui-2Nu{width:100%}.rui-39-wj.rui-38Vok{cursor:not-allowed}.rui-39-wj.rui-3mpqt{color:#fff;background-color:#002f34;border-radius:4px;border:5pxsolid#002f34;padding:07px}.rui-39-wj.rui-3mpqt.rui-LYXL0{color:#002f34;border-color:#fff;background-color:#fff}.rui-39-wj.rui-3mpqt.rui-LYXL0.rui-iPHe_{fill:#002f34}.rui-39-wj.rui-3mpqt.rui-38Vok{background-color:#d8dfe0;color:#7f9799;border-color:#d8dfe0}.rui-39-wj.rui-3mpqt.rui-38Vok.rui-iPHe_{fill:#7f9799}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):hover{background-color:initial;color:#002f34}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):hover.rui-iPHe_{fill:#002f34}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):hover.rui-LYXL0{color:#fff}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):hover.rui-LYXL0.rui-iPHe_{fill:#fff}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):active{background-color:#7f9799;color:#fff;border-color:#7f9799}.rui-39-wj.rui-3mpqt:not(.rui-38Vok):active.rui-iPHe_{fill:#fff}.rui-39-wj.rui-3mpqt:after{background-ime:radial-gradient(circle,hsla(0,0%,100%,.2)10%,transparent10.01%)}.rui-39-wj.rui-3evoE{color:#002f34;border-radius:4px;border:2pxsolid#002f34;padding:010px}.rui-39-wj.rui-3evoE.rui-LYXL0{color:#fff;border-color:#fff;background-color:initial}.rui-39-wj.rui-3evoE.rui-LYXL0.rui-iPHe_{fill:#fff}.rui-39-wj.rui-3evoE.rui-38Vok{color:#7f9799;border-color:#d8dfe0}.rui-39-wj.rui-3evoE.rui-38Vok.rui-LYXL0{border-color:#7f9799}.rui-39-wj.rui-3evoE.rui-38Vok.rui-iPHe_{fill:#7f9799}.rui-39-wj.rui-3evoE:not(.rui-38Vok):hover{border-width:5px;padding:07px}.rui-39-wj.rui-3evoE:not(.rui-38Vok):active{background-color:#7f9799;color:#fff;border-color:#7f9799}.rui-39-wj.rui-3evoE:not(.rui-38Vok):active.rui-LYXL0{color:#7f9799;border-color:#fff;background-color:#fff}.rui-39-wj.rui-3evoE:not(.rui-38Vok):active.rui-LYXL0.rui-iPHe_{fill:#7f9799}.rui-39-wj.rui-3evoE:not(.rui-38Vok):active.rui-iPHe_{fill:#fff}.rui-39-wj.rui-3evoE:after{background-ime:radial-gradient(circle,rgba(0,47,52,.36)10%,transparent10.01%)}.rui-39-wj.rui-3-PNI{color:#002f34;border-bottom:2pxsolid#002f34;padding:0;height:auto}.rui-39-wj.rui-3-PNI.rui-LYXL0{color:#fff;border-bottom-color:#fff}.rui-39-wj.rui-3-PNI.rui-LYXL0.rui-iPHe_{fill:#fff}.rui-39-wj.rui-3-PNI.rui-38Vok{color:#7f9799;border-bottom-color:#d8dfe0}.rui-39-wj.rui-3-PNI.rui-38Vok.rui-iPHe_{fill:#7f9799}.rui-39-wj.rui-3-PNI.rui-38Vok.rui-LYXL0{color:#7f9799;border-bottom-color:#7f9799}.rui-39-wj.rui-3-PNI.rui-38Vok.rui-LYXL0.rui-iPHe_{fill:#7f9799}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):hover{border-bottom-color:transparent}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):hover.rui-LYXL0{border-bottom-width:3px;border-bottom-color:#fff}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):active{color:#;border-bottom-color:#}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):active.rui-iPHe_{fill:#}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):active.rui-LYXL0{color:#d8dfe0;border-bottom-color:#d8dfe0}.rui-39-wj.rui-3-PNI:not(.rui-38Vok):active.rui-LYXL0.rui-iPHe_{fill:#d8dfe0}.rui-39-wj.rui-2NGsu{color:#3a77ff;border:none;padding:0;height:auto}.rui-39-wj.rui-3evoE:after,.rui-39-wj.rui-3mpqt:after{content:"";display:block;position:absolute;width:100%;height:100%;top:0;left:0;pointer-events:none;background-repeat:no-repeat;background-position:50%;transform:scale(25);opacity:0;transition:transform1s,opacity1s}.rui-39-wj.rui-_7v1-{border-radius:50px;box-shadow:02px8px0rgba(0,0,0,.15)}.rui-39-wj:active:after{transform:scale(0);opacity:1;transition:0s}.rui-39-wj.rui-3unfU{display:flex;margin-right:8px}.rui-39-wj.rui-3unfU.rui-yZdex{margin-left:8px;margin-right:0}.rui-1ecEQ{transform:rotateY(-180deg)}.rui-2qwuD{fill:#002f34}.rui-2nV_W{color:#002f34}.rui-l9Tva{background-color:#002f34}.rui-2GuQk{fill:#}.rui-QBOgM{color:#}.rui-2ck2k{background-color:#}.rui-3AnXq{fill:#7f9799}.rui-3cu-7{color:#7f9799}.rui-15EUj{background-color:#7f9799}.rui-3bdZq{fill:#3a77ff}.rui-1NOrE{color:#3a77ff}.rui-3SH24{background-color:#3a77ff}.rui-3r7ir{fill:#6c99ff}.rui-3e6Fm{color:#6c99ff}.rui-32e{background-color:#6c99ff}.rui-1emVo{fill:#9cbbff}.rui-1N1r1{color:#9cbbff}.rui-3mzbI{background-color:#9cbbff}.rui-2UyXg{fill:#ceddff}.rui-hn3wj{color:#ceddff}.rui-3eGd9{background-color:#ceddff}.rui-3JQX-{fill:#ebf1ff}.rui-2mUox{color:#ebf1ff}.rui-2XcFu{background-color:#ebf1ff}.rui-J-p_v{fill:#1d3c81}.rui-3vS3_{color:#1d3c81}.rui-UyiLK{background-color:#1d3c81}.rui-2M7VF{fill:#e}.rui-1YxKy{color:#e}.rui-3bmhE{background-color:#e}.rui-1-xB5{fill:#23e5db}.rui-2HMUb{color:#23e5db}.rui-246by{background-color:#23e5db}.rui-HG2nR{fill:#5aece4}.rui-VlUka{color:#5aece4}.rui-3yeqv{background-color:#5aece4}.rui-3aIl3{fill:#91f2ed}.rui-3WVo7{color:#91f2ed}.rui-1K28E{background-color:#91f2ed}.rui-3rJSe{fill:#c8f8f6}.rui-sP5JY{color:#c8f8f6}.rui-3f21N{background-color:#c8f8f6}.rui-1OE6M{fill:#e9fcfb}.rui-2vrS_{color:#e9fcfb}.rui-3eU--{background-color:#e9fcfb}.rui-3Fq4b{fill:#00a49f}.rui-36kuY{color:#00a49f}.rui-I8kFC{background-color:#00a49f}.rui-2ri_P{fill:#085c5d}.rui-22L__{color:#085c5d}.rui-2inHy{background-color:#085c5d}.rui-3nt01{fill:#ff5636}.rui-ggMEx{color:#ff5636}.rui-27yeK{background-color:#ff5636}.rui-1IMB6{fill:#ff8169}.rui-28bX0{color:#ff8169}.rui-YbLuu{background-color:#ff8169}.rui-1Tefk{fill:#ffaa9a}.rui-1dA9u{color:#ffaa9a}.rui-GqE_v{background-color:#ffaa9a}.rui-DnvfC{fill:#ffd6c9}.rui-Lc5gj{color:#ffd6c9}.rui-29L2s{background-color:#ffd6c9}.rui-3BpQM{fill:#ffeeea}.rui-37bNs{color:#ffeeea}.rui-2rrat{background-color:#ffeeea}.rui-3F3P2{fill:#aa133d}.rui-39Nxk{color:#aa133d}.rui-xng1V{background-color:#aa133d}.rui-3wOvc{fill:#5d142c}.rui-2rZfl{color:#5d142c}.rui-393_U{background-color:#5d142c}.rui-37KM8{fill:#ffce32}.rui-2pqX0{color:#ffce32}.rui-2W6qj{background-color:#ffce32}.rui-3YRZx{fill:#ffe48d}.rui-3qlV0{color:#ffe48d}.rui-1olpW{background-color:#ffe48d}.rui-23jDW{fill:#ffedb2}.rui-1fD6K{color:#ffedb2}.rui-1G7QH{background-color:#ffedb2}.rui-2J41d{fill:#fff6d9}.rui-15wg0{color:#fff6d9}.rui-2xERx{background-color:#fff6d9}.rui-3Xk8Q{fill:#fffbef}.rui-34gic{color:#fffbef}.rui-o6YuP{background-color:#fffbef}.rui-2Joxf{fill:#d2b982}.rui-jwmtK{color:#d2b982}.rui-3TbZm{background-color:#d2b982}.rui-U6VYX{fill:#e}.rui-8KzF5{color:#e}.rui-qJsGV{background-color:#e}.rui-l7uK1{fill:#002f34}.rui-mcZGc{color:#002f34}.rui-3S1LJ{background-color:#002f34}.rui-q1c_-{fill:#002f34}.rui-2gf11{color:#002f34}.rui-13c{background-color:#002f34}.rui-2ZBML{fill:#7f9799}.rui-1hLeK{color:#7f9799}.rui-2dlpd{background-color:#7f9799}.rui-M_r98{fill:#23e5db}.rui-1sH7J{color:#23e5db}.rui-34yH4{background-color:#23e5db}.rui-1ftqL{fill:#00a49f}.rui-3ThiE{color:#00a49f}.rui-3fMgh{background-color:#00a49f}.rui-24ARO{fill:#c8f8f6}.rui-3zOt9{color:#c8f8f6}.rui-14cIS{background-color:#c8f8f6}.rui-3KQ-t{fill:#000}.rui-1O2Hi{color:#000}.rui-1KvEj{background-color:#000}.rui-1YOfn{fill:rgba(0,47,52,0)}.rui-35wKI{color:rgba(0,47,52,0)}.rui-1Qw_8{background-color:rgba(0,47,52,0)}.rui-3bodn{fill:rgba(0,47,52,.03)}.rui-2T0Qh{color:rgba(0,47,52,.03)}.rui-uRIUS{background-color:rgba(0,47,52,.03)}.rui-3yczK{fill:rgba(14,4,5,.2)}.rui-2-0UN{color:rgba(14,4,5,.2)}.rui-1UI-w{background-color:rgba(14,4,5,.2)}.rui-2ncPg{fill:rgba(0,47,52,.36)}.rui-4umQS{color:rgba(0,47,52,.36)}.rui-2dXT6{background-color:rgba(0,47,52,.36)}.rui-1do67{fill:rgba(0,47,52,.36)}.rui-x8H4q{color:rgba(0,47,52,.36)}.rui-1JXLZ{background-color:rgba(0,47,52,.36)}.rui-10_kq{fill:rgba(0,47,52,.64)}.rui-1Eu0K{color:rgba(0,47,52,.64)}.rui-UaD0w{background-color:rgba(0,47,52,.64)}.rui-32D-k{fill:rgba(0,47,52,.64)}.rui-AEByK{color:rgba(0,47,52,.64)}.rui-2HWXB{background-color:rgba(0,47,52,.64)}.rui-4K4Y7{fill:#002f34}.rui-293In{color:#002f34}.rui-3pkBN{background-color:#002f34}.rui-1kebF{fill:#fff}.rui-2A6fe{color:#fff}.rui-114ug{background-color:#fff}.rui-2Z91U{fill:hsla(0,0%,100%,0)}.rui-SzRgk{color:hsla(0,0%,100%,0)}.rui-3ql8s{background-color:hsla(0,0%,100%,0)}.rui-n0puY{fill:hsla(0,0%,100%,.2)}.rui-1-BHH{color:hsla(0,0%,100%,.2)}.rui-29caZ{background-color:hsla(0,0%,100%,.2)}.rui-1t_CT{fill:hsla(0,0%,100%,.2)}.rui-1N1-q{color:hsla(0,0%,100%,.2)}.rui-1bPPc{background-color:hsla(0,0%,100%,.2)}.rui-1nLK2{fill:hsla(0,0%,100%,.2)}.rui-2cRL3{color:hsla(0,0%,100%,.2)}.rui-2Y4PN{background-color:hsla(0,0%,100%,.2)}.rui-2XMuF{fill:hsla(0,0%,100%,.7)}.rui-2B8on{color:hsla(0,0%,100%,.7)}.rui-23pqT{background-color:hsla(0,0%,100%,.7)}.rui-2lrc2{fill:#fff}.rui-UoMCm{color:#fff}.rui-1zyHE{background-color:#fff}.rui-2It78{fill:#fff}.rui-2ZRed{color:#fff}.rui-2junF{background-color:#fff}.rui-3UbVz{fill:#ebeeef}.rui-TEQFR{color:#ebeeef}.rui-1o9Zq{background-color:#ebeeef}.rui-1bPU_{fill:#}.rui-pMqbO{color:#}.rui-1xE0K{background-color:#}.rui-1afFR{fill:#dbdbdb}.rui-{color:#dbdbdb}.rui-nAWG1{background-color:#dbdbdb}.rui-3iWmO{fill:#d8dfe0}.rui-1xWqf{color:#d8dfe0}.rui-2jUjT{background-color:#d8dfe0}.rui-23j9K{fill:#f2f4f5}.rui-2VZno{color:#f2f4f5}.rui-1Iy4e{background-color:#f2f4f5}.rui-1KROD{fill:#f8f9fa}.rui-14SC3{color:#f8f9fa}.rui-3FJ56{background-color:#f8f9fa}.rui-3Omkf{fill:#ff2800}.rui-3NtPx{color:#ff2800}.rui-1AP20{background-color:#ff2800}.rui-41NZZ{fill:#aa133d}.rui-3JTjK{color:#aa133d}.rui-2lFrr{background-color:#aa133d}.rui-lCQcY{fill:#ffd6c9}.rui-e3nHl{color:#ffd6c9}.rui-KCBjC{background-color:#ffd6c9}.rui-3unW8{fill:#4065b3}.rui-1G0oU{color:#4065b3}.rui-RwV2N{background-color:#4065b3}.rui-2vyFP{fill:#4285f4}.rui-yflmV{color:#4285f4}.rui-2UjkF{background-color:#4285f4}.rui-2tGDX{fill:#4cc85b}.rui-3AMkl{color:#4cc85b}.rui-1O-ZC{background-color:#4cc85b}.rui-7HBkG{fill:#dd4b39}.rui-1jufL{color:#dd4b39}.rui-24z_p{background-color:#dd4b39}.rui-2Akh5{fill:#ffce32}.rui-12G4g{color:#ffce32}.rui-1z990{background-color:#ffce32}.rui-1OMSZ{fill:#d2b982}.rui-R_AIR{color:#d2b982}.rui-x-jY7{background-color:#d2b982}.rui-j-8CR{fill:#fff6d9}.rui-Qu0zb{color:#fff6d9}.rui-2iZLC{background-color:#fff6d9}.rui-3sDmE{fill:#f8dd3c}.rui-1ecBs{color:#f8dd3c}.rui-35cyL{background-color:#f8dd3c}.rui-3ZCtF{fill:#f8fbcf}.rui-rSp7r{color:#f8fbcf}.rui-yGZ1F{background-color:#f8fbcf}.rui-2nSe4{fill:#ceddff}.rui-2kiBC{color:#ceddff}.rui-2YxHh{background-color:#ceddff}.rui-1mOdp{fill:#ccd5d6}.rui-i8B{color:#ccd5d6}.rui-2l_5C{background-color:#ccd5d6}.rui-3vTlT{fill:#d8dfe0}.rui-1cB1U{color:#d8dfe0}.rui-NdvXC{background-color:#d8dfe0}.rui-1a9il{fill:#7f9799}.rui-3-psd{color:#7f9799}.rui-1VoKI{background-color:#7f9799}.rui-d-XAJ{fill:#c8f8f6}.rui-2dqOr{color:#c8f8f6}.rui-Z8I_3{background-color:#c8f8f6}@charset"UTF-8";/*!normalize.cssv5.0.0|MITLicense|github.com/necolas/normalize.css*/html{font-family:sans-serif;line-height:1.15;-ms-text-size-adjust:100%;-webkit-text-size-adjust:100%}body{margin:0}article,aside,footer,header,n,section{display:block}h1{font-size:2em;margin:.67em0}figcaption,figure,main{display:block}figure{margin:1em40px}hr{box-sizing:initial;height:0;overflow:visible}pre{font-family:monospace,monospace;font-size:1em}a{background-color:initial;-webkit-text-decoration-skip:objects}a:active,a:hover{outline-width:0}abbr[title]{border-bottom:none;text-decoration:underline;text-decoration:underlinedotted}b,strong{font-weight:inherit;font-weight:bolder}code,kbd,samp{font-family:monospace,monospace;font-size:1em}dfn{font-style:italic}mark{background-color:#ff0;color:#000}small{font-size:80%}sub,sup{font-size:75%;line-height:0;position:relative;vertical-align:initial}sub{bottom:-.25em}sup{top:-.5em}audio,video{display:inline-block}audio:not([controls]){display:none;height:0}img{border-style:none}svg:not(:root){overflow:hidden}button,input,optgroup,select,textarea{font-family:sans-serif;font-size:100%;line-height:1.15;margin:0}button,input{overflow:visible}button,select{text-transform:none}[type=reset],[type=submit],button,html[type=button]{-webkit-appearance:button}[type=button]::-moz-focus-inner,[type=reset]::-moz-focus-inner,[type=submit]::-moz-focus-inner,button::-moz-focus-inner{border-style:none;padding:0}[type=button]:-moz-focusring,[type=reset]:-moz-focusring,[type=submit]:-moz-focusring,button:-moz-focusring{outline:1pxdottedButtonText}fieldset{border:1pxsolidsilver;margin:02px;padding:.35em.625em.75em}legend{box-sizing:border-box;color:inherit;display:table;max-width:100%;padding:0;white-space:normal}progress{display:inline-block;vertical-align:initial}textarea{overflow:auto}[type=checkbox],[type=radio]{box-sizing:border-box;padding:0}[type=number]::-webkit-inner-spin-button,[type=number]::-webkit-outer-spin-button{height:auto}[type=search]{-webkit-appearance:textfield;outline-offset:-2px}[type=search]::-webkit-search-cancel-button,[type=search]::-webkit-search-decoration{-webkit-appearance:none}::-webkit-file-upload-button{-webkit-appearance:button;font:inherit}details,menu{display:block}summary{display:list-item}canvas{display:inline-block}[hidden],template{display:none}body{direction:ltr;text-align:left;text-size-adjust:100%;-moz-osx-font-smoothing:grayscale;-webkit-font-smoothing:antialiased;background-color:#fff;font-family:Arial,Helvetica,sans-serif}body.rui-DR2jK{overflow:hidden}button,input,optgroup,select,textarea{font-family:Arial,Helvetica,sans-serif}input:-webkit-autofill,input:-webkit-autofill:focus,input:-webkit-autofill:hover,select:-webkit-autofill,select:-webkit-autofill:focus,select:-webkit-autofill:hover,textarea:-webkit-autofill,textarea:-webkit-autofill:focus,textarea:-webkit-autofill:hover{box-shadow:none;transition:background-color5000sease-in-out0s}#app#container{margin:0;display:flex;min-height:100vh;flex-direction:column}.rui-ypozj{flex:1;padding-bottom:0;transition-duration:.5s;transition-property:margin;-ms-flex-preferred-size:auto;background-color:#fff;transition-timing-function:cubic-bezier(0,1,.5,1)}.rui-ypozj.rui-YQHpa{padding-bottom:60px}.rui-ypozj>div{width:100%;margin:0auto;max-width:1280px}.rui-ypozj.rui-1lxQ3,.rui-ypozj.rui-2UGu3{margin-left:0}.rui-VBbP6h1{font-size:24px}.rui-VBbP6ul{padding:0;margin:0;list-style:none}.rui-VBbP6ula{text-decoration:none;color:#002f34}.rui-VBbP6ulh3{font-size:20px}.rui-VBbP6ulli.rui-1dPXI{cursor:pointer;height:40px;display:flex;padding-left:10px;align-items:center;text-decoration:none;color:#000;font-size:14px}.rui-VBbP6ulli.rui-1dPXI:before{margin:0;width:40px;height:40px;line-height:40px;text-align:center;color:#000}.rui-VBbP6div>ul{display:flex;flex-direction:column}.rui-VBbP6div>ul>li,.rui-VBbP6div>ul>li>ul{margin:10px}.rui-VBbP6div>ul>li>ul>li>ul{margin:10px}.rui-VBbP6div>ul>li>ul>li>ul>li{margin:5px;display:inline-block;list-style-type:armenian}@mediaonlyscreenand(min-width:1024px){.rui-2kFIn{display:none}}.rui-jAIPe{margin-left:auto;margin-right:auto;margin-bottom:20px}.rui-jAIPe:after{content:"";display:table;clear:both}.rui-jAIPe.rui-eJl9O{float:left;min-height:1px;box-sizing:border-box}.rui-jAIPe.rui-eJl9O.rui-wybRG{padding:5px;border:5pxsolidtransparent}.rui-jAIPe.rui-eJl9O.rui-2oatm{padding:10px;text-align:center}.rui-jAIPe.rui-eJl9O[class*=pull-],.rui-jAIPe.rui-eJl9O[class*=push-]{position:relative}.rui-jAIPe.rui-eJl9O.rui-3KIUM{width:8.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2tiD6{width:16.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2sPIb{width:25%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1aLZ3{width:33.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3KZ_1{width:41.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2052X{width:50%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2otFX{width:58.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3T126{width:66.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3omE3{width:75%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3LkZ8{width:83.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1VcNC{width:91.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-33FUR{width:100%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2OlMP{margin-left:8.33%}.rui-jAIPe.rui-eJl9O.rui-UNfkz{right:8.33%}.rui-jAIPe.rui-eJl9O.rui-1cwt0{left:8.33%}.rui-jAIPe.rui-eJl9O.rui-3BikW{margin-left:16.67%}.rui-jAIPe.rui-eJl9O.rui-zazyD{right:16.67%}.rui-jAIPe.rui-eJl9O.rui-1vUtY{left:16.67%}.rui-jAIPe.rui-eJl9O.rui-37kq2{margin-left:25%}.rui-jAIPe.rui-eJl9O.rui-1Wvnu{right:25%}.rui-jAIPe.rui-eJl9O.rui-31wsz{left:25%}.rui-jAIPe.rui-eJl9O.rui-3hX78{margin-left:33.33%}.rui-jAIPe.rui-eJl9O.rui-11LAB{right:33.33%}.rui-jAIPe.rui-eJl9O.rui-1q6F4{left:33.33%}.rui-jAIPe.rui-eJl9O.rui-21oXI{margin-left:41.67%}.rui-jAIPe.rui-eJl9O.rui-15WQH{right:41.67%}.rui-jAIPe.rui-eJl9O.rui-yIl5B{left:41.67%}.rui-jAIPe.rui-eJl9O.rui-1-GWq{margin-left:50%}.rui-jAIPe.rui-eJl9O.rui-3KmBf{right:50%}.rui-jAIPe.rui-eJl9O.rui-3v4Ik{left:50%}.rui-jAIPe.rui-eJl9O.rui-2mJfb{margin-left:58.33%}.rui-jAIPe.rui-eJl9O.rui-1M9Tb{right:58.33%}.rui-jAIPe.rui-eJl9O.rui-2hRoX{left:58.33%}.rui-jAIPe.rui-eJl9O.rui-3qgQZ{margin-left:66.67%}.rui-jAIPe.rui-eJl9O.rui-34l4_{right:66.67%}.rui-jAIPe.rui-eJl9O.rui-2w_v6{left:66.67%}.rui-jAIPe.rui-eJl9O.rui-x-zvS{margin-left:75%}.rui-jAIPe.rui-eJl9O.rui-14vuE{right:75%}.rui-jAIPe.rui-eJl9O.rui-2soNo{left:75%}.rui-jAIPe.rui-eJl9O.rui-3T3wn{margin-left:83.33%}.rui-jAIPe.rui-eJl9O.rui-UBJfw{right:83.33%}.rui-jAIPe.rui-eJl9O.rui-3fX3i{left:83.33%}.rui-jAIPe.rui-eJl9O.rui-UnFLO{margin-left:91.67%}.rui-jAIPe.rui-eJl9O.rui-YFY1N{right:91.67%}.rui-jAIPe.rui-eJl9O.rui-US964{left:91.67%}.rui-jAIPe.rui-eJl9O.rui-3umfX{margin-left:100%}.rui-jAIPe.rui-eJl9O.rui-3Sjj_{right:100%}.rui-jAIPe.rui-eJl9O.rui-dxdKs{left:100%}.rui-jAIPe.rui-eJl9O.rui-23UXD{padding:16px}@mediaonlyscreenand(min-width:540px)and(max-width:960px){.rui-jAIPe.rui-eJl9O.rui-3AyBr{width:8.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3rajy{width:16.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1wIUW{width:25%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2hTmn{width:33.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3OZhC{width:41.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1l-92{width:50%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3tggI{width:58.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2NJUg{width:66.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1PJvA{width:75%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1gqTw{width:83.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2-9if{width:91.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2MigZ{width:100%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-23Y2M{margin-left:8.33%}.rui-jAIPe.rui-eJl9O.rui-IbGni{right:8.33%}.rui-jAIPe.rui-eJl9O.rui-29YwX{left:8.33%}.rui-jAIPe.rui-eJl9O.rui-2obcN{margin-left:16.67%}.rui-jAIPe.rui-eJl9O.rui-3GRXF{right:16.67%}.rui-jAIPe.rui-eJl9O.rui-jq5Ap{left:16.67%}.rui-jAIPe.rui-eJl9O.rui-sbrxU{margin-left:25%}.rui-jAIPe.rui-eJl9O.rui-2r8wz{right:25%}.rui-jAIPe.rui-eJl9O.rui-2_HLk{left:25%}.rui-jAIPe.rui-eJl9O.rui-aMoLc{margin-left:33.33%}.rui-jAIPe.rui-eJl9O.rui-3pUUX{right:33.33%}.rui-jAIPe.rui-eJl9O.rui-3q_Qu{left:33.33%}.rui-jAIPe.rui-eJl9O.rui-Mfi5A{margin-left:41.67%}.rui-jAIPe.rui-eJl9O.rui-2xZzj{right:41.67%}.rui-jAIPe.rui-eJl9O.rui-QRyZP{left:41.67%}.rui-jAIPe.rui-eJl9O.rui-25FD6{margin-left:50%}.rui-jAIPe.rui-eJl9O.rui-2MEoc{right:50%}.rui-jAIPe.rui-eJl9O.rui-_gdcb{left:50%}.rui-jAIPe.rui-eJl9O.rui-3uPle{margin-left:58.33%}.rui-jAIPe.rui-eJl9O.rui-fDAu4{right:58.33%}.rui-jAIPe.rui-eJl9O.rui-29hEm{left:58.33%}.rui-jAIPe.rui-eJl9O.rui-2kXX-{margin-left:66.67%}.rui-jAIPe.rui-eJl9O.rui-IkfSw{right:66.67%}.rui-jAIPe.rui-eJl9O.rui-2k8Q0{left:66.67%}.rui-jAIPe.rui-eJl9O.rui-19Bn_{margin-left:75%}.rui-jAIPe.rui-eJl9O.rui-AImnQ{right:75%}.rui-jAIPe.rui-eJl9O.rui-1dZR9{left:75%}.rui-jAIPe.rui-eJl9O.rui-2u5II{margin-left:83.33%}.rui-jAIPe.rui-eJl9O.rui-3tcrc{right:83.33%}.rui-jAIPe.rui-eJl9O.rui-2nkrw{left:83.33%}.rui-jAIPe.rui-eJl9O.rui-2mWyX{margin-left:91.67%}.rui-jAIPe.rui-eJl9O.rui-1mvtv{right:91.67%}.rui-jAIPe.rui-eJl9O.rui-3sYkJ{left:91.67%}.rui-jAIPe.rui-eJl9O.rui-3ZOod{margin-left:100%}.rui-jAIPe.rui-eJl9O.rui-2VzjC{right:100%}.rui-jAIPe.rui-eJl9O.rui-3Fv7s{left:100%}}@mediaonlyscreenand(min-width:960px)and(max-width:1024px){.rui-jAIPe.rui-eJl9O.rui-2MxPN{width:8.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1JFzE{width:16.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-hkybr{width:25%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2Utah{width:33.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1G_NY{width:41.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-1CDsP{width:50%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3tgBN{width:58.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-38KWq{width:66.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2C-oZ{width:75%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-nZ5rF{width:83.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2mZco{width:91.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-27muF{width:100%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-326SL{margin-left:8.33%}.rui-jAIPe.rui-eJl9O.rui-3ylxq{right:8.33%}.rui-jAIPe.rui-eJl9O.rui-1uMsD{left:8.33%}.rui-jAIPe.rui-eJl9O.rui-1alMa{margin-left:16.67%}.rui-jAIPe.rui-eJl9O.rui-2Bt7F{right:16.67%}.rui-jAIPe.rui-eJl9O.rui-2hEhE{left:16.67%}.rui-jAIPe.rui-eJl9O.rui-325Gq{margin-left:25%}.rui-jAIPe.rui-eJl9O.rui-31eWY{right:25%}.rui-jAIPe.rui-eJl9O.rui-28YcF{left:25%}.rui-jAIPe.rui-eJl9O.rui-RueVP{margin-left:33.33%}.rui-jAIPe.rui-eJl9O.rui-3N41M{right:33.33%}.rui-jAIPe.rui-eJl9O.rui--x5vK{left:33.33%}.rui-jAIPe.rui-eJl9O.rui-1iRXs{margin-left:41.67%}.rui-jAIPe.rui-eJl9O.rui-14fbJ{right:41.67%}.rui-jAIPe.rui-eJl9O.rui-SaNrY{left:41.67%}.rui-jAIPe.rui-eJl9O.rui-3YDxp{margin-left:50%}.rui-jAIPe.rui-eJl9O.rui-fwYvT{right:50%}.rui-jAIPe.rui-eJl9O.rui-1_JSE{left:50%}.rui-jAIPe.rui-eJl9O.rui-WAHMx{margin-left:58.33%}.rui-jAIPe.rui-eJl9O.rui-85eF2{right:58.33%}.rui-jAIPe.rui-eJl9O.rui-1jk29{left:58.33%}.rui-jAIPe.rui-eJl9O.rui-25IGC{margin-left:66.67%}.rui-jAIPe.rui-eJl9O.rui-3PUU8{right:66.67%}.rui-jAIPe.rui-eJl9O.rui-2SUfS{left:66.67%}.rui-jAIPe.rui-eJl9O.rui-1KpU0{margin-left:75%}.rui-jAIPe.rui-eJl9O.rui-77EF4{right:75%}.rui-jAIPe.rui-eJl9O.rui--wwpD{left:75%}.rui-jAIPe.rui-eJl9O.rui-3_-N0{margin-left:83.33%}.rui-jAIPe.rui-eJl9O.rui-3Msqg{right:83.33%}.rui-jAIPe.rui-eJl9O.rui-1Bocl{left:83.33%}.rui-jAIPe.rui-eJl9O.rui-2tFSu{margin-left:91.67%}.rui-jAIPe.rui-eJl9O.rui--5RLb{right:91.67%}.rui-jAIPe.rui-eJl9O.rui-3Msvh{left:91.67%}.rui-jAIPe.rui-eJl9O.rui-3O926{margin-left:100%}.rui-jAIPe.rui-eJl9O.rui-3cNMt{right:100%}.rui-jAIPe.rui-eJl9O.rui-2xaYz{left:100%}}@mediaonlyscreenand(min-width:1024px){.rui-jAIPe.rui-eJl9O.rui-28kF3{width:8.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-13Leg{width:16.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-NGNwV{width:25%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-30Sko{width:33.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-199PT{width:41.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3c9lW{width:50%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3mdz3{width:58.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-dOH8s{width:66.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3Lo_q{width:75%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3rgmd{width:83.33%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-2nh8X{width:91.67%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-3XEcC{width:100%;margin-left:auto;left:auto;right:auto}.rui-jAIPe.rui-eJl9O.rui-39zkn{margin-left:8.33%}.rui-jAIPe.rui-eJl9O.rui-JB2h8{right:8.33%}.rui-jAIPe.rui-eJl9O.rui-1WP_h{left:8.33%}.rui-jAIPe.rui-eJl9O.rui-3aCLL{margin-left:16.67%}.rui-jAIPe.rui-eJl9O.rui-2W_Pn{right:16.67%}.rui-jAIPe.rui-eJl9O.rui-35xzJ{left:16.67%}.rui-jAIPe.rui-eJl9O.rui-1gZfm{margin-left:25%}.rui-jAIPe.rui-eJl9O.rui-3bqwd{right:25%}.rui-jAIPe.rui-eJl9O.rui-2LYP5{left:25%}.rui-jAIPe.rui-eJl9O.rui-1rNth{margin-left:33.33%}.rui-jAIPe.rui-eJl9O.rui-2F_wH{right:33.33%}.rui-jAIPe.rui-eJl9O.rui-2RuYG{left:33.33%}.rui-jAIPe.rui-eJl9O.rui-2-uB0{margin-left:41.67%}.rui-jAIPe.rui-eJl9O.rui-pEeL5{right:41.67%}.rui-jAIPe.rui-eJl9O.rui-2wrNM{left:41.67%}.rui-jAIPe.rui-eJl9O.rui-1a_63{margin-left:50%}.rui-jAIPe.rui-eJl9O.rui-hyeP8{right:50%}.rui-jAIPe.rui-eJl9O.rui-2jeoh{left:50%}.rui-jAIPe.rui-eJl9O.rui-28QjK{margin-left:58.33%}.rui-jAIPe.rui-eJl9O.rui-1H7hz{right:58.33%}.rui-jAIPe.rui-eJl9O.rui-TJG66{left:58.33%}.rui-jAIPe.rui-eJl9O.rui-3Rp7O{margin-left:66.67%}.rui-jAIPe.rui-eJl9O.rui-1piT5{right:66.67%}.rui-jAIPe.rui-eJl9O.rui-2w8vg{left:66.67%}.rui-jAIPe.rui-eJl9O.rui-3J8B3{margin-left:75%}.rui-jAIPe.rui-eJl9O.rui-1uYoS{right:75%}.rui-jAIPe.rui-eJl9O.rui-30qF2{left:75%}.rui-jAIPe.rui-eJl9O.rui-2nLUS{margin-left:83.33%}.rui-jAIPe.rui-eJl9O.rui-2fvey{right:83.33%}.rui-jAIPe.rui-eJl9O.rui-hgF08{left:83.33%}.rui-jAIPe.rui-eJl9O.rui-32Ncv{margin-left:91.67%}.rui-jAIPe.rui-eJl9O.rui-1yt_Q{right:91.67%}.rui-jAIPe.rui-eJl9O.rui-wxknx{left:91.67%}.rui-jAIPe.rui-eJl9O.rui-1jkyp{margin-left:100%}.rui-jAIPe.rui-eJl9O.rui-3qwMm{right:100%}.rui-jAIPe.rui-eJl9O.rui-3ECad{left:100%}.rui-jAIPe.rui-eJl9O.rui-23UXD{padding:24px}}.rui-2THJR:after,.rui-2THJR:before{display:inline-block;font-size:24px;vertical-align:middle;font-family:olx-icons!important;speak:none;font-style:normal;font-weight:400;font-variant:normal;text-transform:none;line-height:1;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale}@font-face{font-family:olx-icons;src:url(/chunks/legacy/olx-icons.olx.a8b0c53d3bfa45b811f5f4bf.woff2)format("woff2"),url(/chunks/legacy/olx-icons.olx.cc4499be9cde3dd.woff)format("woff"),url(/chunks/legacy/olx-icons.olx.6d86fdb878c04ffcdbaac7161.eot)format("embedded-opentype"),url(/chunks/legacy/olx-icons.olx.32a0a77dea95b912ca4b83eaa0f4d022.ttf)format("truetype"),url(/chunks/legacy/olx-icons.olx.a9a943a1722fac4de.svg)format("svg");font-weight:400;font-style:normal}.rui-3fqxO:before{content:"\E900"}.rui-33vfx:before{content:"\E902"}.rui-3VuMW:before{content:"\E904"}.rui-1sLTc:before{content:"\E905"}.rui-2lPX4:before{content:"\E906"}.rui-2k9mv:before{content:"\E908"}.rui-2q1xs:before{content:"\E909"}.rui-1tM0n:before{content:"\E90A"}.rui-lu7x2:before{content:"\E90B"}.rui-3MjwL:before{content:"\E90C"}.rui-1--Lv:before{content:"\E910"}.rui-3akyk:before{content:"\E911"}.rui-A9TyJ:before{content:"\E912"}.rui-waHXH:before{content:"\E913"}.rui-10xTP:before{content:"\E917"}.rui-hePCV:before{content:"\E91C"}.rui-3yrAK:before{content:"\E91E"}.rui-3AlGm:before{content:"\E91F"}.rui-2yT9E:before{content:"\E920"}.rui-1lP6n:before{content:"\E922"}.rui-23Px3:before{content:"\E923"}.rui-2KEoh:before{content:"\E924"}.rui-2MY6L:before{content:"\E925"}.rui-BPS-E:before{content:"\E927"}.rui-1ctuG:before{content:"\E928"}.rui-3D_mS:before{content:"\E92A"}.rui-1qQSA:before{content:"\E92B"}.rui-2dx_9:before{content:"\E92C"}.rui-1W1IK:before{content:"\E92D"}.rui-1LCqL:before{content:"\E92E"}.rui-1Xwp3:before{content:"\E92F"}.rui-3tmEc:before{content:"\E930"}.rui-106Ze:before{content:"\E931"}.rui-1K2wK:before{content:"\E932"}.rui-2u-sf:before{content:"\E933"}.rui-2m-:before{content:"\E935"}.rui-3mu5w:before{content:"\E936"}.rui-YgJOU:before{content:"\E938"}.rui-1laOD:before{content:"\E939"}.rui-YXKcN:before{content:"\E93A"}.rui-2LwTC:before{content:"\E93B"}.rui-85v8-:before{content:"\E93D"}.rui-2-VVH:before{content:"\E93E"}.rui-3yTj5:before{content:"\E941"}.rui-31Zzz:before{content:"\E942"}.rui-3nqUq:before{content:"\E943"}.rui-QoRwE:before{content:"\E944"}.rui-2brwY:before{content:"\E945"}.rui-2VGLH:before{content:"\E947"}.rui-1jB34:before{content:"\E948"}.rui-1LVJ7:before{content:"\E949"}.rui-1hTSS:before{content:"\E94C"}.rui-jUVBI:before{content:"\E94D"}.rui-y2AOi:before{content:"\E94E"}.rui-tWi90:before{content:"\E94F"}.rui-3azL3:before{content:"\E951"}.rui-3JsfK:before{content:"\E953"}.rui-375mO:before{content:"\E954"}.rui-1gbL8:before{content:"\E956"}.rui-heydd:before{content:"\E957"}.rui-296aY:before{content:"\E958"}.rui-XftC8:before{content:"\E959"}.rui-34l4i:before{content:"\E95A"}.rui-2F9gt:before{content:"\E95B"}.rui-NMMnQ:before{content:"\E95D"}.rui-2igGX:before{content:"\E961"}.rui-37aiX:before{content:"\E962"}.rui-1wneR:before{content:"\E963"}.rui-1n4ts:before{content:"\E964"}.rui-3yjzZ:before{content:"\E965"}.rui-WwiZh:before{content:"\E968"}.rui-CN_Dq:before{content:"\E969"}.rui-uvCuU:before{content:"\E96D"}.rui-1HYWZ:before{content:"\E96F"}.rui-2zME2:before{content:"\E971"}.rui-3E3gm:before{content:"\E972"}.rui-3Fcl7:before{content:"\E973"}.rui-34qej:before{content:"\E975"}.rui-3Vdfx:before{content:"\E976"}.rui-yyBvn:before{content:"\E977"}.rui-3QJun:before{content:"\E978"}.rui-12v_R:before{content:"\E979"}.rui-3KPvs:before{content:"\E97A"}.rui-3UJh5:before{content:"\E97B"}.rui-1McB0:before{content:"\E97C"}.rui-1920c:before{content:"\E97D"}.rui-ulQWj:before{content:"\E97E"}.rui-1QHor:before{content:"\E981"}.rui-2ipzp:before{content:"\E9DA"}.rui-1JApE:before{content:"\E9DC"}.rui-1ElgH:before{content:"\E9DD"}.rui-1bxkL:before{content:"\E9DE"}.rui-JYW0x:before{content:"\E9DF"}.rui-36fJz:before{content:"\E9E0"}.rui-3Ds3i:before{content:"\E9E1"}.rui-2Zsbo:before{content:"\E982"}.rui-33j2Z:before{content:"\E983"}.rui-PtJW8:before{content:"\E984"}.rui-1dvnL:before{content:"\E985"}.rui-2v1SX:before{content:"\E93F"}.rui-1hYCG:before{content:"\E986"}.rui-1XPHR:before{content:"\E987"}.rui-2In0l:before{content:"\E988"}.rui-1tTGV:before{content:"\E989"}.rui-NVdiB:before{content:"\E98A"}.rui-2zkXU:before{content:"\E98B"}.rui-1Fw:before{content:"\E98C"}.rui-26Up7:before{content:"\E98D"}.rui-mZsSB:before{content:"\E98E"}.rui-2rKe4:before{content:"\E98F"}.rui-1BHLk:before{content:"\E990"}.rui-17jtW:before{content:"\E991"}.rui-1Icv7:before{content:"\E9DB"}.rui-1A4VW:before{content:"\E960"}.rui-29j4s:before{content:"\E95C"}.rui-2nh8m:before{content:"\E91D"}.rui-36tfv:before{content:"\E901"}.rui-zqvkN:before{content:"\E90E"}.rui-2qwuD{fill:#002f34}.rui-2nV_W{color:#002f34}.rui-l9Tva{background-color:#002f34}.rui-2GuQk{fill:#}.rui-QBOgM{color:#}.rui-2ck2k{background-color:#}.rui-3AnXq{fill:#7f9799}.rui-3cu-7{color:#7f9799}.rui-15EUj{background-color:#7f9799}.rui-3bdZq{fill:#3a77ff}.rui-1NOrE{color:#3a77ff}.rui-3SH24{background-color:#3a77ff}.rui-3r7ir{fill:#6c99ff}.rui-3e6Fm{color:#6c99ff}.rui-32e{background-color:#6c99ff}.rui-1emVo{fill:#9cbbff}.rui-1N1r1{color:#9cbbff}.rui-3mzbI{background-color:#9cbbff}.rui-2UyXg{fill:#ceddff}.rui-hn3wj{color:#ceddff}.rui-3eGd9{background-color:#ceddff}.rui-3JQX-{fill:#ebf1ff}.rui-2mUox{color:#ebf1ff}.rui-2XcFu{background-color:#ebf1ff}.rui-J-p_v{fill:#1d3c81}.rui-3vS3_{color:#1d3c81}.rui-UyiLK{background-color:#1d3c81}.rui-2M7VF{fill:#e}.rui-1YxKy{color:#e}.rui-3bmhE{background-color:#e}.rui-1-xB5{fill:#23e5db}.rui-2HMUb{color:#23e5db}.rui-246by{background-color:#23e5db}.rui-HG2nR{fill:#5aece4}.rui-VlUka{color:#5aece4}.rui-3yeqv{background-color:#5aece4}.rui-3aIl3{fill:#91f2ed}.rui-3WVo7{color:#91f2ed}.rui-1K28E{background-color:#91f2ed}.rui-3rJSe{fill:#c8f8f6}.rui-sP5JY{color:#c8f8f6}.rui-3f21N{background-color:#c8f8f6}.rui-1OE6M{fill:#e9fcfb}.rui-2vrS_{color:#e9fcfb}.rui-3eU--{background-color:#e9fcfb}.rui-3Fq4b{fill:#00a49f}.rui-36kuY{color:#00a49f}.rui-I8kFC{background-color:#00a49f}.rui-2ri_P{fill:#085c5d}.rui-22L__{color:#085c5d}.rui-2inHy{background-color:#085c5d}.rui-3nt01{fill:#ff5636}.rui-ggMEx{color:#ff5636}.rui-27yeK{background-color:#ff5636}.rui-1IMB6{fill:#ff8169}.rui-28bX0{color:#ff8169}.rui-YbLuu{background-color:#ff8169}.rui-1Tefk{fill:#ffaa9a}.rui-1dA9u{color:#ffaa9a}.rui-GqE_v{background-color:#ffaa9a}.rui-DnvfC{fill:#ffd6c9}.rui-Lc5gj{color:#ffd6c9}.rui-29L2s{background-color:#ffd6c9}.rui-3BpQM{fill:#ffeeea}.rui-37bNs{color:#ffeeea}.rui-2rrat{background-color:#ffeeea}.rui-3F3P2{fill:#aa133d}.rui-39Nxk{color:#aa133d}.rui-xng1V{background-color:#aa133d}.rui-3wOvc{fill:#5d142c}.rui-2rZfl{color:#5d142c}.rui-393_U{background-color:#5d142c}.rui-37KM8{fill:#ffce32}.rui-2pqX0{color:#ffce32}.rui-2W6qj{background-color:#ffce32}.rui-3YRZx{fill:#ffe48d}.rui-3qlV0{color:#ffe48d}.rui-1olpW{background-color:#ffe48d}.rui-23jDW{fill:#ffedb2}.rui-1fD6K{color:#ffedb2}.rui-1G7QH{background-color:#ffedb2}.rui-2J41d{fill:#fff6d9}.rui-15wg0{color:#fff6d9}.rui-2xERx{background-color:#fff6d9}.rui-3Xk8Q{fill:#fffbef}.rui-34gic{color:#fffbef}.rui-o6YuP{background-color:#fffbef}.rui-2Joxf{fill:#d2b982}.rui-jwmtK{color:#d2b982}.rui-3TbZm{background-color:#d2b982}.rui-U6VYX{fill:#e}.rui-8KzF5{color:#e}.rui-qJsGV{background-color:#e}.rui-l7uK1{fill:#002f34}.rui-mcZGc{color:#002f34}.rui-3S1LJ{background-color:#002f34}.rui-q1c_-{fill:#002f34}.rui-2gf11{color:#002f34}.rui-13c{background-color:#002f34}.rui-2ZBML{fill:#7f9799}.rui-1hLeK{color:#7f9799}.rui-2dlpd{background-color:#7f9799}.rui-M_r98{fill:#23e5db}.rui-1sH7J{color:#23e5db}.rui-34yH4{background-color:#23e5db}.rui-1ftqL{fill:#00a49f}.rui-3ThiE{color:#00a49f}.rui-3fMgh{background-color:#00a49f}.rui-24ARO{fill:#c8f8f6}.rui-3zOt9{color:#c8f8f6}.rui-14cIS{background-color:#c8f8f6}.rui-3KQ-t{fill:#000}.rui-1O2Hi{color:#000}.rui-1KvEj{background-color:#000}.rui-1YOfn{fill:rgba(0,47,52,0)}.rui-35wKI{color:rgba(0,47,52,0)}.rui-1Qw_8{background-color:rgba(0,47,52,0)}.rui-3bodn{fill:rgba(0,47,52,.03)}.rui-2T0Qh{color:rgba(0,47,52,.03)}.rui-uRIUS{background-color:rgba(0,47,52,.03)}.rui-3yczK{fill:rgba(14,4,5,.2)}.rui-2-0UN{color:rgba(14,4,5,.2)}.rui-1UI-w{background-color:rgba(14,4,5,.2)}.rui-2ncPg{fill:rgba(0,47,52,.36)}.rui-4umQS{color:rgba(0,47,52,.36)}.rui-2dXT6{background-color:rgba(0,47,52,.36)}.rui-1do67{fill:rgba(0,47,52,.36)}.rui-x8H4q{color:rgba(0,47,52,.36)}.rui-1JXLZ{background-color:rgba(0,47,52,.36)}.rui-10_kq{fill:rgba(0,47,52,.64)}.rui-1Eu0K{color:rgba(0,47,52,.64)}.rui-UaD0w{background-color:rgba(0,47,52,.64)}.rui-32D-k{fill:rgba(0,47,52,.64)}.rui-AEByK{color:rgba(0,47,52,.64)}.rui-2HWXB{background-color:rgba(0,47,52,.64)}.rui-4K4Y7{fill:#002f34}.rui-293In{color:#002f34}.rui-3pkBN{background-color:#002f34}.rui-1kebF{fill:#fff}.rui-2A6fe{color:#fff}.rui-114ug{background-color:#fff}.rui-2Z91U{fill:hsla(0,0%,100%,0)}.rui-SzRgk{color:hsla(0,0%,100%,0)}.rui-3ql8s{background-color:hsla(0,0%,100%,0)}.rui-n0puY{fill:hsla(0,0%,100%,.2)}.rui-1-BHH{color:hsla(0,0%,100%,.2)}.rui-29caZ{background-color:hsla(0,0%,100%,.2)}.rui-1t_CT{fill:hsla(0,0%,100%,.2)}.rui-1N1-q{color:hsla(0,0%,100%,.2)}.rui-1bPPc{background-color:hsla(0,0%,100%,.2)}.rui-1nLK2{fill:hsla(0,0%,100%,.2)}.rui-2cRL3{color:hsla(0,0%,100%,.2)}.rui-2Y4PN{background-color:hsla(0,0%,100%,.2)}.rui-2XMuF{fill:hsla(0,0%,100%,.7)}.rui-2B8on{color:hsla(0,0%,100%,.7)}.rui-23pqT{background-color:hsla(0,0%,100%,.7)}.rui-2lrc2{fill:#fff}.rui-UoMCm{color:#fff}.rui-1zyHE{background-color:#fff}.rui-2It78{fill:#fff}.rui-2ZRed{color:#fff}.rui-2junF{background-color:#fff}.rui-3UbVz{fill:#ebeeef}.rui-TEQFR{color:#ebeeef}.rui-1o9Zq{background-color:#ebeeef}.rui-1bPU_{fill:#}.rui-pMqbO{color:#}.rui-1xE0K{background-color:#}.rui-1afFR{fill:#dbdbdb}.rui-{color:#dbdbdb}.rui-nAWG1{background-color:#dbdbdb}.rui-3iWmO{fill:#d8dfe0}.rui-1xWqf{color:#d8dfe0}.rui-2jUjT{background-color:#d8dfe0}.rui-23j9K{fill:#f2f4f5}.rui-2VZno{color:#f2f4f5}.rui-1Iy4e{background-color:#f2f4f5}.rui-1KROD{fill:#f8f9fa}.rui-14SC3{color:#f8f9fa}.rui-3FJ56{background-color:#f8f9fa}.rui-3Omkf{fill:#ff2800}.rui-3NtPx{color:#ff2800}.rui-1AP20{background-color:#ff2800}.rui-41NZZ{fill:#aa133d}.rui-3JTjK{color:#aa133d}.rui-2lFrr{background-color:#aa133d}.rui-lCQcY{fill:#ffd6c9}.rui-e3nHl{color:#ffd6c9}.rui-KCBjC{background-color:#ffd6c9}.rui-3unW8{fill:#4065b3}.rui-1G0oU{color:#4065b3}.rui-RwV2N{background-color:#4065b3}.rui-2vyFP{fill:#4285f4}.rui-yflmV{color:#4285f4}.rui-2UjkF{background-color:#4285f4}.rui-2tGDX{fill:#4cc85b}.rui-3AMkl{color:#4cc85b}.rui-1O-ZC{background-color:#4cc85b}.rui-7HBkG{fill:#dd4b39}.rui-1jufL{color:#dd4b39}.rui-24z_p{background-color:#dd4b39}.rui-2Akh5{fill:#ffce32}.rui-12G4g{color:#ffce32}.rui-1z990{background-color:#ffce32}.rui-1OMSZ{fill:#d2b982}.rui-R_AIR{color:#d2b982}.rui-x-jY7{background-color:#d2b982}.rui-j-8CR{fill:#fff6d9}.rui-Qu0zb{color:#fff6d9}.rui-2iZLC{background-color:#fff6d9}.rui-3sDmE{fill:#f8dd3c}.rui-1ecBs{color:#f8dd3c}.rui-35cyL{background-color:#f8dd3c}.rui-3ZCtF{fill:#f8fbcf}.rui-rSp7r{color:#f8fbcf}.rui-yGZ1F{background-color:#f8fbcf}.rui-2nSe4{fill:#ceddff}.rui-2kiBC{color:#ceddff}.rui-2YxHh{background-color:#ceddff}.rui-1mOdp{fill:#ccd5d6}.rui-i8B{color:#ccd5d6}.rui-2l_5C{background-color:#ccd5d6}.rui-3vTlT{fill:#d8dfe0}.rui-1cB1U{color:#d8dfe0}.rui-NdvXC{background-color:#d8dfe0}.rui-1a9il{fill:#7f9799}.rui-3-psd{color:#7f9799}.rui-1VoKI{background-color:#7f9799}.rui-d-XAJ{fill:#c8f8f6}.rui-2dqOr{color:#c8f8f6}.rui-Z8I_3{background-color:#c8f8f6}.rui-1Culj::-webkit-scrollbar-track{background-color:#dbdbdb}.rui-1Culj::-webkit-scrollbar{width:3px;background-color:#dbdbdb}.rui-1Culj::-webkit-scrollbar-thumb{background-color:#000}.laq-layout__title{position:relative;margin:16px0;font-size:20px;font-weight:500}@mediascreenand(max-width:768px){.laq-layout__title{margin-top:0;margin-bottom:32px;font-size:20px;font-weight:500;font-stretch:normal;font-style:normal;line-height:1.1}}.laq-layout__subtitle{margin:16px0;font-size:14px;font-weight:400}.laq-layout__hint{margin:8px0;font-size:14px;line-height:1.29}.laq-layout__hint,.laq-layout__use{font-weight:400;font-stretch:normal;font-style:normal;letter-spacing:normal;color:#7f9799}.laq-layout__use{font-size:10px;line-height:1}.laq-layout__usea{margin:04px;text-decoration:underline;color:#7f9799}.laq-layout__usea:visited{color:#7f9799}.laq-layout__btn-close{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;position:absolute;right:16px;width:17px;height:22px;padding:2px00;box-sizing:border-box;border:0;background-color:initial;color:#002f34;cursor:pointer}.laq-layout__btn-closesvg{width:17px;height:17px}.laq-layout__btn-closesvgpath{stroke:currentColor!important;fill:currentColor!important}.laq-layout__btn-closesvgg{transform:translate(1px,1px)}.laq-layout.laq-layout--default{width:430px;min-height:180px;padding:24px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;display:flex;flex-direction:column;position:fixed;left:50%;top:50%;width:600px;transform:translate(-50%,-50%)}@mediascreenand(max-width:768px){.laq-layout.laq-layout--default{width:calc(100vw-32px);min-height:180px;padding:16px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;top:0;left:0;width:100vw;height:100%;transform:none;overflow-y:auto}}.laq-layout.laq-layout--thank_you{width:430px;min-height:180px;padding:24px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;display:flex;flex-direction:column;position:fixed;left:50%;top:50%;width:600px;transform:translate(-50%,-50%)}@mediascreenand(max-width:768px){.laq-layout.laq-layout--thank_you{width:calc(100vw-32px);min-height:180px;padding:16px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;position:fixed;right:16px;top:50%;left:16px;transform:translateY(-50%)}}.laq-top-n{flex-direction:row-reverse;display:flex;height:24px;margin-bottom:36px}.laq-top-n__content{flex:10;display:flex;align-items:center;padding:016px00}.laq-top-n__content+.layout__btn-close{float:right}.laq-top-n__step{flex:10;height:8px;border-radius:8px;background-color:#2b65ea;opacity:.15}.laq-top-n__step--active{opacity:1}.laq-top-n__step+.laq-top-n__step{margin-left:12px}.laq-top-n.laq-layout__btn-close{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;position:relative;right:0}@mediascreenand(max-width:768px){.laq-top-n{flex-wrap:wrap;height:40px}.laq-top-n__content{flex-basis:100%;padding:0}.laq-top-n.laq-layout__btn-close{margin-bottom:16px}}.laq-bottom-n{margin-top:48px}.laq-bottom-n__content{display:flex;justify-content:space-between}.laq-bottom-n__content.btn--survey-back,.laq-bottom-n__content.btn--survey-next,.laq-bottom-n__content.btn--survey-submit{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;display:flex;padding:4px;border:0;font-size:20px;font-weight:500;background-color:initial;cursor:pointer}.laq-bottom-n__content.btn--survey-back:disabled,.laq-bottom-n__content.btn--survey-next:disabled,.laq-bottom-n__content.btn--survey-submit:disabled{filter:opacity(.5);pointer-events:none}.laq-bottom-n__content.btn--survey-back{border-radius:50%;color:#2b65ea!important}.laq-bottom-n__content.btn--survey-backsvgpath{stroke:#2b65ea!important;fill:#2b65ea!important}.laq-bottom-n__content.btn--survey-next{color:#2b65ea!important}.laq-bottom-n__content.btn--survey-nextsvgpath{stroke:#2b65ea!important;fill:#2b65ea!important}.laq-bottom-n__content.btn--survey-submit{color:#2b65ea!important}@mediascreenand(max-width:768px){.laq-bottom-n{margin-top:auto;padding-top:12px}}.laq-layout--default.laq-question--checkbox_group.laq-layout__content{width:100%;overflow:hidden;border-radius:4px;border:1pxsolid#7f9799}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group{list-style:none;padding:0;margin:0}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item{min-height:53px;font-size:16px;font-weight:400;font-stretch:normal;font-style:normal;line-height:1.25;letter-spacing:normal;cursor:pointer;border-bottom:1pxsolid#7f9799}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item:last-child{border-bottom:0}@mediascreenand(min-width:768px){.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item:not(.checkbox-group__item--active):hover{background:hsla(0,0%,82.4%,.)}}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item--active{font-weight:500;background:#e2fcfa}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item.item__content{display:flex;align-items:center;padding:16px}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item.item__contentinput[type=checkbox]{flex:0024px;align-self:center;display:inline-block;position:relative;height:24px;width:24px;margin:016px00;overflow:hidden;outline:none;background-color:#fff;border:2pxsolid#000;border-radius:4px;cursor:pointer;-webkit-appearance:none}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item.item__contentinput[type=checkbox]:after{content:"";position:relative;display:block;left:50%;top:50%;transform:translate(-50%,-50%);font-size:24px;color:#fff}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item.item__contentinput[type=checkbox]:checked{border-color:#c}.laq-layout--default.laq-question--checkbox_group.laq-layout__content.laq-checkbox-group__item.item__contentinput[type=checkbox]:checked:after{content:"";background-ime:url("data:ime/png;base64,iVBORw0KGgoAAAANSUhEUgAAABgAAAAYCAYAAADgdz34AAAABGdBTUEAALGPC/xhBQAAACBjSFJNAAB6JgAIQAAPoAAACA6AAAdTAAAOpgAAA6mAAAF3CculE8AAAABmJLR0QAAAAAAAD5Q7t/AAAACXBIWXMAAA7EAAAOxVKw4bAAAAf0lEQVRIx+2SvQmAUAyED3Ebl3AIfwrdw0q0dBNHtFD4bCyCiCgvNvKuTMh3yREpKuqNgOxLeswGTriRdc0iwplbR8tTnAEOHhcKAHqpt+beDjW3h+DK5XJkFwA+kOwAY0pl66ZX4y3hxmQ0cYXF8uAS/1c8XeK7edS/tAN3POiWK+uHwQAAACV0RVh0ZGF0ZTpjcmVhdGUAMjAyMC0wNi0wM1QxMzoxODowMiswMDowMN2L2rYAAAAldEVYdGRhdGU6bW9kaWZ5ADIwMjAtMDYtMDNUMTM6MTg6MDIrMDA6MDCs1mIKAAAXRFWHRTb2Z0d2FyZQB3d3cuaW5rc2NhcGUub3Jnm+48GgAAAABJRU5ErkJggg==");background-color:#c;background-size:24px;width:43px;height:43px;background-position:50%}.laq-layout--default.laq-question--single_input.laq-layout__content{width:100%;overflow:hidden}.laq-layout--default.laq-question--single_input.laq-layout__contentinput[type=text]{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;width:100%;height:40px;padding:8px;border-radius:4px;border:1pxsolid#000;font-size:16px;color:#002f34}.laq-layout--default.laq-question--multiline_input.laq-layout__content{width:100%;overflow:hidden}.laq-layout--default.laq-question--multiline_input.laq-layout__contenttextarea{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;width:100%;height:180px;padding:8px;border-radius:4px;border:1pxsolid#000;resize:vertical;font-size:16px;color:#002f34}.laq-layout--default.laq-question--radio_group.laq-layout__content{width:100%;overflow:hidden;border-radius:4px;border:1pxsolid#7f9799}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group{list-style:none;padding:0;margin:0}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item{min-height:53px;font-size:16px;font-weight:400;font-stretch:normal;font-style:normal;line-height:1.25;letter-spacing:normal;cursor:pointer;border-bottom:1pxsolid#7f9799}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item:last-child{border-bottom:0}@mediascreenand(min-width:768px){.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item:not(.laq-radio-group__item--active):hover{background:hsla(0,0%,82.4%,.)}}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item--active{font-weight:500;background:#e2fcfa}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item.item__content{display:flex;align-items:center;padding:16px}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item.item__contentinput[type=radio]{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;flex:0024px;align-self:center;display:inline-block;position:relative;height:24px;width:24px;margin:016px00;outline:none;background-color:#fff;border-radius:50%;border:2pxsolid#000;cursor:pointer;-webkit-appearance:none}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item.item__contentinput[type=radio]:after{content:"";position:relative;display:block;height:12px;width:12px;left:50%;top:50%;transform:translate(-50%,-50%);background-color:initial;border-radius:50%}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item.item__contentinput[type=radio]:checked{border-color:#c}.laq-layout--default.laq-question--radio_group.laq-layout__content.laq-radio-group__item.item__contentinput[type=radio]:checked:after{background-color:#c}.laq-layout--default.laq-question--rating.laq-layout__title{margin-bottom:84px}.laq-layout--default.laq-question--rating.laq-layout__content{width:100%;overflow:hidden;margin-bottom:126px}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar{display:flex;justify-content:space-between;width:100%;padding:012px;height:68px;border-radius:34px;background-ime:linear-gradient(90deg,#ff86860,#ffce8517%,#fff28546%,#e7ff8586%,#b4ff8599%)}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item{height:100%;align-self:center;color:#000;font-size:20px;font-weight:400;font-stretch:normal;font-style:normal;line-height:normal;letter-spacing:normal;cursor:pointer;display:flex;flex-basis:45px;justify-content:center}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item--active{position:relative;font-size:24px;font-weight:500;text-align:center}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item--active:after{content:"";position:absolute;width:56px;height:56px;transform:translateY(6px);box-shadow:02px4px0rgba(0,0,0,.5);border-radius:50%;background-color:#fff;z-index:1}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item>input{display:none}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item>span{align-self:center;z-index:2}@mediascreenand(max-width:768px){.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar{height:40px;border-radius:20px;padding:05px}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item{-webkit-tap-highlight-color:transparent;-webkit-touch-callout:none;user-select:none;outline:none;flex-basis:34px;font-size:14px}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item--active{font-size:20px}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar__item--active:after{width:34px;height:34px;transform:translateY(3px)}}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar--text{display:flex;justify-content:space-between;margin-top:16px}.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar--text>div{font-size:16px;line-height:1.25}@mediascreenand(max-width:768px){.laq-layout--default.laq-question--rating.laq-layout__content.laq-rating-bar--text>div{font-size:14px}}.laq-layout--thank_you.laq-layout__title{max-width:calc(100%-24px)}@mediascreenand(max-width:768px){.laq-layout--thank_you.laq-layout__title{margin-top:0}}.laq-layout--welcome{width:430px;min-height:180px;padding:24px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;position:fixed;right:60px;bottom:60px}.laq-layout--welcome.laq-layout__use{margin-top:28px}.laq-layout--welcome.laq-layout__actions{display:flex;justify-content:space-between;margin-top:36px}.laq-layout--welcome.laq-layout__actions--accept,.laq-layout--welcome.laq-layout__actions--decline{font-size:14px;font-weight:500;font-stretch:normal;font-style:normal;line-height:1.29;cursor:pointer;border:2pxsolid}.laq-layout--welcome.laq-layout__actions--decline{float:left;width:152px;height:40px;margin-right:8px;border-radius:4px;color:#002f34;background-color:#fff;border-color:#002f34}.laq-layout--welcome.laq-layout__actions--accept{float:right;width:152px;height:40px;margin-left:8px;border-radius:4px;color:#fff;background-color:#2965ea;border-color:#2965ea}@mediascreenand(max-width:768px){.laq-layout--welcome{width:calc(100vw-32px);min-height:180px;padding:16px;font-family:Roboto,sans-serif;color:#002f34;border-radius:4px;box-shadow:02px4px0rgba(0,0,0,.5);background-color:#fff;position:fixed;right:16px;bottom:16px;left:16px}.laq-layout--welcome__title{font-size:16px}.laq-layout--welcome__subtitle{font-size:12px}}.laq-survey{font-stretch:normal;font-style:normal;letter-spacing:normal;color:#002f34!important}.laq-survey,.laq-survey*{font-family:Roboto,sans-serif!important}.laq-survey*{box-sizing:border-box}.laq-survey:after{font-family:Roboto,sans-serif!important}.laq-survey--overlay{position:fixed;width:100%;height:100%;top:0;right:0;bottom:0;left:0;background:rgba(0,0,0,.4);z-index:999}/*#sourceMappingURL=desktop-vendors~main.olx.4aecae729f70.css.map*/.J65Qg{top:0;z-index:9;color:#fff;position:fixed;font-size:10px;padding:4px;text-transform:uppercase;background-color:rgba(0,0,0,.3)}.J65Qg>span{text-transform:lowercase}.J65Qg>span._3cVeP{text-transform:uppercase}.slick-list,.slick-slider,.slick-track{position:relative;display:block}.slick-loading.slick-slide,.slick-loading.slick-track{visibility:hidden}.slick-slider{box-sizing:border-box;user-select:none;-webkit-touch-callout:none;-khtml-user-select:none;touch-action:pan-y;overflow:hidden;-webkit-tap-highlight-color:transparent}.slick-list{overflow:hidden;margin:0;padding:0}.slick-list:focus{outline:0}.slick-list.drging{cursor:pointer;cursor:hand}.slick-slider.slick-list,.slick-slider.slick-track{transform:translateZ(0)}.slick-track{top:0;left:0}.slick-track:after,.slick-track:before{display:table;content:""}.slick-track:after{clear:both}.slick-slide{display:none;float:left;height:100%;min-height:1px}[dir=rtl].slick-slide{float:right}.slick-slideimg{display:block}.slick-slide.slick-loadingimg{display:none}.slick-slide.drgingimg{pointer-events:none}.slick-initialized.slick-slide{display:block}.slick-vertical.slick-slide{display:block;height:auto;border:1pxsolidtransparent}.slick-arrow.slick-hidden{display:none}.rc-slider{position:relative;height:32px;padding:16px0;width:100%;border-radius:6px;touch-action:none}.rc-slider,.rc-slider*{box-sizing:border-box;-webkit-tap-highlight-color:rgba(0,47,52,0)}.rc-slider-rail{position:absolute;width:100%;background-color:rgba(0,47,52,.36);height:4px;border-radius:6px}.rc-slider-track{position:absolute;left:0;height:4px;border-radius:6px;background-color:#002f34}.rc-slider-handle{position:absolute;margin-top:-10px;width:24px;height:24px;cursor:pointer;cursor:grab;border-radius:50%;border:2pxsolid#002f34;background-color:#fff;touch-action:pan-x}.rc-slider-handle:hover{border-color:#002f34}.rc-slider-handle:active{border-color:#002f34;box-shadow:02px8px0rgba(0,0,0,.15);cursor:grabbing}.rc-slider-handle:focus{border-color:#002f34;box-shadow:0005px#002f34;outline:none}.rc-slider-mark{position:absolute;top:18px;left:0;width:100%;font-size:12px}.rc-slider-mark-text{position:absolute;display:inline-block;vertical-align:middle;text-align:center;cursor:pointer;color:#002f34}.rc-slider-mark-text-active{color:rgba(0,47,52,.64)}.rc-slider-step{position:absolute;width:100%;height:4px;background:transparent}.rc-slider-dot{position:absolute;bottom:-2px;margin-left:-4px;width:8px;height:8px;border:2pxsolidrgba(14,4,5,.2);background-color:#fff;cursor:pointer;border-radius:50%;vertical-align:middle}.rc-slider-dot:first-child,.rc-slider-dot:last-child{margin-left:-4px}.rc-slider-dot-active{border-color:rgba(14,4,5,.2)}.rc-slider-disabled{background-color:rgba(14,4,5,.2)}.rc-slider-disabled.rc-slider-track{background-color:#ebeeef}.rc-slider-disabled.rc-slider-dot,.rc-slider-disabled.rc-slider-handle{border-color:#ebeeef;box-shadow:none;background-color:#fff;cursor:not-allowed}.rc-slider-disabled.rc-slider-dot,.rc-slider-disabled.rc-slider-mark-text{cursor:not-allowed!important}.rc-slider-vertical{width:14px;height:100%;padding:05px}.rc-slider-vertical.rc-slider-rail{height:100%;width:4px}.rc-slider-vertical.rc-slider-track{left:5px;bottom:0;width:4px}.rc-slider-vertical.rc-slider-handle{margin-left:-5px;margin-bottom:-7px;touch-action:pan-y}.rc-slider-vertical.rc-slider-mark{top:0;left:18px;height:100%}.rc-slider-vertical.rc-slider-step{height:100%;width:4px}.rc-slider-vertical.rc-slider-dot{left:2px;margin-bottom:-4px}.rc-slider-vertical.rc-slider-dot:first-child,.rc-slider-vertical.rc-slider-dot:last-child{margin-bottom:-4px}.rc-slider-tooltip-zoom-down-appear,.rc-slider-tooltip-zoom-down-enter,.rc-slider-tooltip-zoom-down-lee{animation-duration:.3s;animation-fill-mode:both;display:block!important;animation-play-state:paused}.rc-slider-tooltip-zoom-down-appear.rc-slider-tooltip-zoom-down-appear-active,.rc-slider-tooltip-zoom-down-enter.rc-slider-tooltip-zoom-down-enter-active{animation-name:rcSliderTooltipZoomDownIn;animation-play-state:running}.rc-slider-tooltip-zoom-down-lee.rc-slider-tooltip-zoom-down-lee-active{animation-name:rcSliderTooltipZoomDownOut;animation-play-state:running}.rc-slider-tooltip-zoom-down-appear,.rc-slider-tooltip-zoom-down-enter{transform:scale(0);animation-timing-function:cubic-bezier(.23,1,.32,1)}.rc-slider-tooltip-zoom-down-lee{animation-timing-function:cubic-bezier(.755,.05,.855,.06)}@keyframestaH1b{0%{opacity:0;transform-origin:50%100%;transform:scale(0)}to{transform-origin:50%100%;transform:scale(1)}}@keyframesLvvx4{0%{transform-origin:50%100%;transform:scale(1)}to{opacity:0;transform-origin:50%100%;transform:scale(0)}}.rc-slider-tooltip{position:absolute;left:-9999px;top:-9999px;visibility:visible}.rc-slider-tooltip,.rc-slider-tooltip*{box-sizing:border-box;-webkit-tap-highlight-color:rgba(0,47,52,0)}.rc-slider-tooltip-hidden{display:none}.rc-slider-tooltip-placement-top{padding:4px08px}.rc-slider-tooltip-inner{padding:6px2px;min-width:24px;height:24px;font-size:12px;line-height:1;color:#fff;text-align:center;text-decoration:none;background-color:#ebeeef;border-radius:6px;box-shadow:02px8px0rgba(0,0,0,.15)}.rc-slider-tooltip-arrow{position:absolute;width:0;height:0;border-color:transparent;border-style:solid}.rc-slider-tooltip-placement-top.rc-slider-tooltip-arrow{bottom:4px;left:50%;margin-left:-4px;border-width:4px4px0;border-top-color:rgba(14,4,5,.2)}._3FF3q{-webkit-tap-highlight-color:transparent;touch-action:manipulation;color:#002f34}@mediaonlyscreenand(min-width:540px)and(max-width:1024px){._3FF3q{min-width:1024px;height:100vh;overflow:auto}}._2Vwul{z-index:30;bottom:0;background:#fff;padding:24px;display:flex;align-items:center;transition:bottom.5sease-out;height:auto;max-height:600px;position:fixed;overflow:hidden;border-top:1pxsolidrgba(14,4,5,.2);width:100%;box-sizing:border-box}._2Vwul.ryZhc{margin:0;font-size:12px;line-height:18px;flex-basis:75%;box-sizing:border-box;padding-right:24px;text-align:justify}._2Vwul.ryZhca{color:#23e5db;text-decoration:none}._2Vwul.DMSis{flex-basis:25%;justify-content:space-around;text-align:right}._2Vwul.DMSis._1WEQo{font-size:12px;line-height:18px;color:#002f34;cursor:pointer;text-decoration:none;margin-left:8px;text-transform:uppercase}@mediaonlyscreenand(max-width:960px){._2Vwul{flex-direction:column}._2Vwul.ryZhc{padding-right:0}._2Vwul.DMSis{width:100%;justify-content:flex-end;margin-top:8px}}._2Vwul._2j3AO{bottom:-100%}.Bv1yc._3WZNX{display:block}.Bv1yc._1LdXw{background-color:rgba(136,131,131,.6)}@mediaonlyscreenand(max-width:960px){.Bv1yc._2AC5E{width:100%;padding:24px;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;height:100%;overflow:auto}}@mediaonlyscreenand(min-width:960px){.Bv1yc._2AC5E{margin:016px;padding:16px;width:100%;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;width:400px;overflow:hidden;border-radius:3px;position:relative;height:584px}}@mediaonlyscreenand(max-width:960px){.Bv1yc.SJzZq{width:100%;padding:24px;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;height:100%;overflow:auto}}@mediaonlyscreenand(min-width:960px){.Bv1yc.SJzZq{margin:016px;width:100%;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;width:400px;overflow:hidden;border-radius:3px;position:relative;height:600px;padding:16px20px}}@mediaonlyscreenand(max-width:960px){.Bv1yc._2ANII{background-color:#fff;width:100%;height:100%;overflow:auto;padding:0}}@mediaonlyscreenand(min-width:960px){.Bv1yc._2ANII{margin:016px;width:100%;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;width:800px;overflow:hidden;border-radius:3px;position:relative;height:424px;padding:0}}.Bv1yc._1033p{width:400px}.Bv1yc._183pA{cursor:pointer}.Bv1yc._2_t7-,.Bv1yc._3IKPU{margin:4px0;display:inline-flex;width:100%}.Bv1yc._2_t7-._2Y__g,.Bv1yc._2Y__g._3IKPU{margin:8px0}.Bv1yc._19Bwy{opacity:.5}.Bv1yc.Zn3dH{height:100%;position:relative}.Bv1yc.Zn3dH._2TaUb{display:flex;flex-direction:column;position:absolute;bottom:0}.Bv1yc._3IKPU{padding:016px;justify-content:left;font-size:15px;text-transform:none}.Bv1yc._3IKPU._2Y__g{margin:8px0}.Bv1yc._3zuBL{padding:004px;margin:4px032px;display:block;text-align:center;text-decoration:underline;text-underline-position:under;font-size:14px;font-weight:700;cursor:pointer}.Bv1yc._11PsF{margin:16px0;font-size:14px;text-align:center;text-transform:uppercase;font-weight:500}.Bv1yc._30E5g{z-index:1;position:relative;text-align:center;margin:20px016px;font-size:12px}.Bv1yc._1-xhv{margin:0;padding:020px;text-align:center;color:rgba(0,47,52,.64);font-size:12px}.Bv1yc._1-xhv._24rr9{text-decoration:none;color:#3a77ff}.Bv1yc._3Wm16{padding:0;margin:20px0;text-align:center;color:rgba(0,47,52,.64);font-size:12px}.Bv1yc.ZK4NN{background-color:#ff5636}.Bv1yc.BEs0P{padding:0;width:100%;height:100%;min-height:250px;border-radius:3px;box-sizing:border-box}@mediaonlyscreenand(max-width:960px){.Bv1yc.BEs0P._3D13s,.Bv1yc.BEs0P._2jvJo{min-height:90px;display:flex;flex-direction:column;margin:20px0;align-items:center;position:relative}.Bv1yc.BEs0P._3D13s>div,.Bv1yc.BEs0P._2jvJo>div{width:100%}.Bv1yc.BEs0P._3D13s.nakMI,.Bv1yc.BEs0P._2jvJo.nakMI{display:flex;align-items:center;margin:-16px0016px}.Bv1yc.BEs0P._3D13s.nakMI._2tlmC,.Bv1yc.BEs0P._2jvJo.nakMI._2tlmC{display:flex;justify-content:center;align-items:center;width:18px;height:18px;border-radius:50%;background-color:#fed949;font-size:8px;font-weight:700}.Bv1yc.BEs0P._3D13s.nakMI.u1hJM,.Bv1yc.BEs0P._2jvJo.nakMI.u1hJM{font-size:12px;color:#002f34;margin-left:8px;font-weight:700}.Bv1yc.BEs0P._3D13s._1EB1u,.Bv1yc.BEs0P._2jvJo._1EB1u{width:400px}}@mediaonlyscreenand(min-width:960px){.Bv1yc.BEs0P._3D13s,.Bv1yc.BEs0P._2jvJo{margin:28px0;min-height:90px}}@mediaonlyscreenand(min-width:960px){.Bv1yc.BEs0P._2jvJo{margin:28px024px;min-height:auto}}.Bv1yc.BEs0P._3wIhS{color:#002f34;text-decoration:underline;text-underline-offset:4px;font-size:14px}.Bv1yc.BEs0P._2CROK{color:#7f9799;pointer-events:none}.Bv1yc.BEs0P.GOtKF{background-color:#fefbf0;font-size:14px;line-height:20px;padding:16px;margin:0032px}.Bv1yc._1-x0N{margin:0;overflow:hidden;font-size:20px;font-weight:700}.Bv1yc._2fd67,.Bv1yc._1-x0N{padding:0;text-align:center;color:#002f34}.Bv1yc._2fd67{margin:20px00;font-size:14px}.Bv1yc.zU0QY{display:flex;justify-content:space-between;align-items:center;margin:20px8px0}.Bv1yc._3yoXq{height:100%;width:100%;display:flex;justify-content:center;align-items:center;position:absolute;left:0;top:0;right:0;bottom:0}.Bv1yc._3yoXqsvg{display:block;stroke:#002f34}.Bv1yc._3bVv6,.Bv1yc._3Tc0w{display:block;margin:008px;text-align:center;font-size:12px}.Bv1yc._3Tc0w{color:#002f34}.Bv1yc._3bVv6{color:#ff2800}.Bv1yc._1zFpm{display:flex;height:100px;margin:20px0;align-items:center;justify-content:center}.Bv1yc._1zFpm._2joAm{display:inline-block}.Bv1yc._1zFpm._2joAm:first-child{margin:020px00}.Bv1yc._1zFpm._2joAm:last-child{margin:00020px}.Bv1yc._1zFpm._2KZZE{display:inline-block;height:3px;width:35px;position:relative;background-color:#c8f8f6}.Bv1yc._1zFpm._2KZZE:before{position:absolute;right:-5px;top:-3px;content:"";width:0;height:0;border-top:5pxsolidtransparent;border-bottom:5pxsolidtransparent;border-left:5pxsolid#c8f8f6}.Bv1yc._1zFpm._2KZZE:after{content:"";position:absolute;left:-4px;display:block;top:-1px;height:5px;width:5px;background-color:#c8f8f6;border-radius:50%}.Bv1yc.vyRpT{height:100%;background:#fff}.Bv1yc.vyRpT._3lvdT,.Bv1yc.vyRpT.k0Ay4{color:#002f34}.Bv1yc.vyRpT.k0Ay4{font-size:24px;line-height:32px;font-weight:700}.Bv1yc.vyRpT._3lvdT{font-size:14px;line-height:20px;margin-top:24px}.Bv1yc.vyRpT._3lvdTa{text-decoration:none;color:#23e5db}.Bv1yc.vyRpT.Q6Wim{display:block;text-align:center}.Bv1yc.vyRpT._2BLgu{margin:32px016px}.Bv1yc.vyRpT._2QNx2{font-size:14px;font-weight:700;text-transform:uppercase;cursor:pointer;color:#23e5db;margin:16px0}.Bv1yc._2nCjh{width:100%;height:40px;display:block;cursor:pointer;padding:016px;position:relative;box-sizing:border-box;font-size:14px;color:rgba(0,47,52,.64);border:1pxsolidrgba(14,4,5,.2);display:flex;justify-content:center;align-items:center}.Bv1yc._2nCjh._2rxrM{top:11px;left:12px;width:20px;height:20px;position:absolute;color:#dd4b39;font-size:24px}.Bv1yc._1Y7B3{height:240px;margin:45px0;text-align:center}.n_QHM{top:0;left:0;right:0;bottom:0;width:100%;z-index:10;height:100%;display:table;position:fixed;background:rgba(55,71,79,.7)}._2uUJF,.RjCf1,.F_45E{z-index:1;top:16px;cursor:pointer;position:absolute}.RjCf1,.F_45E{right:16px}.F_45E{top:24px;right:24px}._2uUJF{left:12px}._1zZ1Y{text-align:center;background:#002f34;background:radial-gradient(circleattopcenter,#7f97990,#7f979950%,#002f3450.3%,#002f34);color:#fff}@mediaonlyscreenand(max-width:960px){._1zZ1Y{width:100%;padding:24px;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;height:100%;overflow:auto}}@mediaonlyscreenand(min-width:960px){._1zZ1Y{margin:016px;padding:16px;width:100%;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;width:400px;overflow:hidden;border-radius:3px;position:relative;height:552px}}._22p_1{z-index:1;top:10px;cursor:pointer;position:absolute;color:rgba(0,47,52,.64);right:10px}._3_Qvv{color:#002f34;flex:1;display:flex;flex-direction:column;justify-content:center}._3dZSu._3dZSu:before{font-size:160px;line-height:.8}._1uPvP{display:block;text-transform:uppercase;font-weight:700}._2dMQG{flex:1;display:flex;flex-direction:column;justify-content:center;align-items:center;width:80%;margin:auto}@mediaonlyscreenand(max-width:960px){._2dMQG{width:100%}}.w7X-M{margin:0;font-size:34px;font-weight:700}.XcORt{font-size:16px;margin:16px0}._1QkBn{font-weight:700;color:#fff;text-decoration:none;margin:0008px}._208QV{width:100%;max-width:112px}._3_esGbody,._3_esGbutton,._3_esGinput,._3_esGoptgroup,._3_esGselect,._3_esGtextarea{font-family:Roboto,Arial,Helvetica,sans-serif}.dgriSbody,.dgriSbutton,.dgriSinput,.dgriSoptgroup,.dgriSselect,.dgriStextarea{font-family:Tajawal,Arial,Helvetica,sans-serif}._2ILg9{margin:0auto;display:flex;flex-direction:column;justify-content:center;align-items:center;text-align:center}._2ILg9._2nIvK{max-width:200px}._2ILg9.or1En{font-size:16px;line-height:24px;color:rgba(0,47,52,.64);font-weight:700}._2ILg9._3VWZ4{font-size:14px;line-height:20px;width:60%;color:rgba(0,47,52,.36)}._2ILg9._2ESAr,._2ILg9._2nIvK,._2ILg9._3VWZ4,._2ILg9.or1En{margin:0016px}.bCpBN{position:absolute;top:50%;left:50%;margin-right:-50%;transform:translate(-50%,-50%)}/*#sourceMappingURL=desktop-main.olx.9bfbbf95d2c31cd.css.map*/._1jYKO{z-index:8;width:100%;min-height:48px;box-sizing:border-box}._1jYKO._2XmAi{text-decoration:none;cursor:pointer}._1jYKO.f3R3d{margin:auto;width:100%;max-width:1200px;display:flex;justify-content:space-between}._1jYKO.f3R3d._33BRf{margin:0auto00;max-width:900px}._1jYKO._3-lxv{padding-right:8px}._1jYKO._2sI8Z{display:flex;background:#ebeeef;padding:16px0;font-size:14px;line-height:20px}@mediaonlyscreenand(max-width:1280px){._1jYKO._2sI8Z{padding:16px16px32px}}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z{padding:0;flex-direction:column;width:100%;border:none;background:#fff}}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z._16-_3{background:#ebeeef}}._1jYKO._2sI8Z.MIUFp{display:grid;grid-template-columns:repeat(4,1fr);row-gap:24px;justify-items:start;width:100%}._1jYKO._2sI8Z.fRN33{font-weight:700;text-transform:uppercase;flex-basis:20%}._1jYKO._2sI8Z.fRN33._3v7Ep{display:block;margin:05%08%;width:127px;flex-basis:auto}._1jYKO._2sI8Z.fRN33._3ps7k{text-transform:none}._1jYKO._2sI8Z.fRN33._1oPQy{flex-basis:10%;margin:048px00}._1jYKO._2sI8Z.fRN33ul{padding:0;list-style:none;margin:8px00}._1jYKO._2sI8Z.fRN33._2XmAi{font-weight:400;text-transform:none;text-decoration:none;cursor:pointer;font-size:12px;color:#002f34;color:rgba(0,47,52,.64)}._1jYKO._2sI8Z.fRN33._2XmAi:hover{color:#002f34}._1jYKO._2sI8Z.fRN33._2oZEg{display:flex;flex-direction:column;justify-content:space-between}@mediaonlyscreenand(min-width:960px){._1jYKO._2sI8Z.fRN33._2oZEg.kxIhX{align-items:flex-end}}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z.fRN33._1NJc2.zE__2{justify-content:center}}._1jYKO._2sI8Z.fRN33._1NJc2.Ljcld{display:block;color:#002f34}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z.fRN33._1NJc2.Ljcld{font-weight:400;text-transform:none;font-size:16px}}._1jYKO._2sI8Z.fRN33._1NJc2.Ljcld._2kvbx{font-weight:400}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z.fRN33._1NJc2.Ljcld._2kvbx{font-size:14px}}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2PW3S{display:flex;padding:6px00}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2XmAi{display:inline-block}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2XmAispansvg{width:23.5px;height:23.5px;padding-right:8px}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2XmAispansvgpath{fill:rgba(0,47,52,.64)}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2f61j{display:inline-block}._1jYKO._2sI8Z.fRN33._1NJc2._2lcRE._2f61jspansvg{width:24px;height:24px;padding-right:8px}._1jYKO._2sI8Z.fRN33._1NJc2._2lcREi{padding-right:8px}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z.fRN33._1NJc2{display:flex;align-items:center;justify-content:space-between;padding:16px24px;border-top:1pxsolidrgba(14,4,5,.2);border-bottom:1pxsolidrgba(14,4,5,.2)}}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z.fRN33._1NJc2._3eqGZ{display:flex;flex-direction:column;align-items:flex-start;justify-content:space-between;padding:16px024px;margin:24px20px0;border-top:1pxdashed#002f34;border-bottom:none}}@mediaonlyscreenand(max-width:960px){._1jYKO._2sI8Z._1oPQy{padding:28px20px16px}._1jYKO._2sI8Z._1oPQyimg{height:20px;width:auto}._1jYKO._2sI8Z._1oPQyimg._3bwu3{height:28px}}._1jYKO._2sI8Z._27Gxj{border-top:none;display:flex;flex-direction:column;flex-wrap:wrap;align-items:flex-start;justify-content:space-evenly;gap:16px;padding:16px}._1jYKO._2sI8Z._27Gxj._12C5q{padding-left:calc(127px+13%)}._1jYKO._2sI8Z._27Gxj._39xZ6._2y1_K{width:100%;max-width:1200px;margin:auto}._1jYKO._2sI8Z._27Gxj._39xZ6._2y1_K._a5gV{width:100%;max-width:1200px;margin:auto;display:flex;flex-direction:row;flex-wrap:wrap;align-items:flex-start;justify-content:flex-start}._1jYKO._2sI8Z._27Gxj._2y1_K._3SZXC{margin:-14px00}._1jYKO._2sI8Z._27Gxj._2y1_K._2mlRf{font-weight:700;font-size:14px;letter-spacing:0;color:#002f34}._1jYKO._2sI8Z._27Gxj._2y1_K._3NVHR{margin:4px00;font-size:14px;letter-spacing:0;color:#}._1jYKO._2sI8Z._27Gxj._2y1_K._3NVHRa{font-weight:700;text-decoration:underline;margin:0008px;color:#002f34}._1jYKO._2sI8Z._27Gxj._2y1_K._3NVHR._1GlUR{max-width:968px}._1jYKO._2sI8Z._27Gxj._2y1_K._a5gV{display:flex;flex-direction:row;flex-wrap:wrap;align-items:flex-start;justify-content:center}._1jYKO._2sI8Z._27Gxj._2y1_K._a5gV._5FCJZ{display:flex;flex-direction:row;flex-wrap:wrap;align-items:flex-start;justify-content:space-evenly;gap:8px}._1jYKO._2sI8Z._27Gxj._2y1_K._a5gV._5FCJZ._1D9a5,._1jYKO._2sI8Z._27Gxj._2y1_K._a5gV._5FCJZ._1D9a5>a{color:#;text-decoration:none}._1jYKO._2sI8Z._27Gxj._2y1_K._a5gV._5FCJZ:not(:last-child){margin:070px00}._1jYKO._1P8{color:#fff;font-size:12px;line-height:18px;background:#002f34;padding:16px0}@mediaonlyscreenand(max-width:1280px){._1jYKO._1P8{padding:16px}}._1jYKO._1P8.f3R3d{flex-direction:row-reverse}._1jYKO._1P8.fRN33span{font-weight:700;padding-right:8px}._1jYKO._1P8.fRN33._2XmAi{color:#fff}._1jYKO._1P8._3OZhk.f3R3d{justify-content:center}._1jYKOdiv._3cDez._3cDez._3cDez.nCkZW{border-top:none;margin:08px}._1jYKOdiv._3cDez._3cDez._3cDez.nCkZW._3D8Do{background-color:#fff}._1jYKOdiv._3cDez._3cDez._3cDez.nCkZW.Ljcld{font-weight:700;font-size:14px;padding:10px12px;color:#002f34}._1jYKOdiv._3cDez._3cDez._3cDez.nCkZW._2aFs8{height:40px;width:40px}._1jYKOdiv._3cDez._3cDez._3cDez.nCkZWh1{margin:0;font-size:inherit;line-height:inherit;font-weight:inherit}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3hoLW{padding:0}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3hoLW>div{margin-left:12px}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3CjwS{border-top:none;margin:08px;padding:0}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3CjwS>div{margin-left:12px}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3CjwS.Ljcld{font-size:14px;padding:10px12px;color:#}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3CjwS._2aFs8{height:40px;width:40px}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL.QgL4_,._1jYKOdiv._3cDez._3cDez._3cDez._3mheL.QgL4_._3mheL{padding:0}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._3JCm_{padding:024px32px}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._2XmAi{padding-left:16px}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._2XmAi._2f61jli{font-size:14px;line-height:2.74;list-style-type:none}._1jYKOdiv._3cDez._3cDez._3cDez._3mheL._2XmAi._2f61jlia{text-decoration:none;color:#}._1jYKOdiv._3cDez._3cDez._3cDez._2XmAi{margin:0;padding:8px12px;background:#ebeeef}._1jYKOdiv._3cDez._3cDez._3cDez._2XmAili{font-size:14px;line-height:2.74;list-style-type:none}._1jYKOdiv._3cDez._3cDez._3cDez._2XmAilia{text-decoration:none;color:#000}._1jYKOdiv._3cDez._3cDez._3cDez._2XmAi._2f61j{padding:036px}._1jYKOdiv._3cDez._3cDez._3cDez._2XmAi._2f61jlia{color:#}._1jYKOdiv._3cDez._3cDez._3cDez._3mOII{padding:16px24px;font-size:16px;border-top:1pxsolidrgba(14,4,5,.2)}._1jYKOdiv._3cDez._3cDez._3cDez._3mOII.aWS5h{text-decoration:none;color:#000;margin-left:12px}._1jYKOdiv._3cDez._3cDez._3cDez._3Ge4n{font-size:14px;margin:08px020px;padding:10px12px}._1jYKOdiv._3cDez._3cDez._3cDez._3Ge4n.aWS5h{text-decoration:none;color:#}._1jYKO._2RwxB{padding:8px20px16px}._1jYKO._2RwxB._2mlRf{font-weight:700;font-size:14px;letter-spacing:.1px;color:#002f34}._1jYKO._2RwxB._3NVHR{margin:18px00;font-size:14px;letter-spacing:0;color:rgba(0,47,52,.64)}._1jYKO._2RwxB._3NVHRa{font-weight:700;text-decoration:underline;margin:0008px;color:#002f34}._1jYKO._2RwxB._a5gV{display:flex;flex-direction:column;flex-wrap:wrap;align-items:flex-start;justify-content:space-evenly;margin:18px00;gap:20px}._1jYKO._2RwxB._a5gV._5FCJZ{display:flex;flex-direction:row;flex-wrap:wrap;align-items:flex-start;justify-content:space-evenly;gap:8px}._1jYKO._2RwxB._a5gV._5FCJZ._1D9a5,._1jYKO._2RwxB._a5gV._5FCJZ._1D9a5>a{color:rgba(0,47,52,.64);text-decoration:none}._1jYKO.E6MPP{padding:10px36px;color:rgba(0,47,52,.64)}._10R92{border-top:1pxsolidrgba(0,47,52,.2);padding:16px24px16px36px;display:flex;font-size:16px;text-decoration:none;color:#000}._164_b:after,._164_b:before{content:"";font-family:olx-icons;speak:none;font-style:normal;font-weight:400;font-variant:normal;text-transform:none;line-height:1;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale}._1oy9H{background-color:rgba(14,4,5,.2)}.BCAyI{width:100%;margin:0auto;height:72px}@mediaonlyscreenand(max-width:1024px)and(min-width:540px){.BCAyI{min-width:1024px}}.BCAyI._2fu44{display:flex;margin-left:auto;margin-right:auto;max-width:1280px;position:relative}.BCAyI._23yNr{top:0;height:47px;background-color:#002f34}.BCAyI._1B5Sf,.BCAyI._23yNr{position:fixed;left:0;z-index:10;margin:0auto;width:100%;box-sizing:border-box}.BCAyI._1B5Sf{padding:10px16px;background-color:#fff}.BCAyI._1B5Sf._2FZ38{padding:16px40px16px48px;background-color:#f8f9fa}.BCAyI._1B5Sf._2MVAx{padding:16px40px16px48px}.BCAyI._1B5Sf._2MVAx:after{background-color:#fff}.BCAyI._1B5Sf:after{content:"";background-color:rgba(0,47,52,.03);position:absolute;top:0;left:0;z-index:-1;width:100%;height:100%}.BCAyI._1B5Sf._2KctL{margin:016px;display:flex;flex:1}@mediaonlyscreenand(max-width:540px){.BCAyI._1B5Sf._2KctL{display:none}}.BCAyI._1B5Sf._2KctL._2LQLU{max-width:650px}.BCAyI._1B5Sf._2h-xp{display:none}.BCAyI.r45De{top:47px}.BCAyI._2d97D{top:0}.BCAyI._2Fhdk{box-shadow:010px20px0rgba(55,70,95,.12)}._1Ow7B{z-index:10;width:100%;position:fixed;background:#fff;box-sizing:border-box;box-shadow:01px4px0rgba(0,0,0,.1)}@mediaonlyscreenand(max-width:1024px)and(min-width:540px){._1Ow7B{position:absolute;min-width:1024px}}._1Ow7Bh1{margin-top:0}._1Ow7B.bbYwQ{position:relative;margin-right:15px;z-index:3}._1Ow7B.bbYwQ>span{float:left}._1Ow7B.bbYwQ._2UKrO{color:#002f34;height:48px;width:48px}._1Ow7B.bbYwQ._1vQjO{color:#002f34}@mediaonlyscreenand(min-width:1024px){._1Ow7B.bbYwQ._1vQjO{display:none}}._3JQLX{filter:grayscale(1)}._2Y7K_{width:50%;float:left}@mediaonlyscreenand(max-width:1023px){._2Y7K_{width:100%;float:none}}._3W9XC{width:100%;display:flex;flex-direction:column;align-items:flex-start;justify-content:center}@media(-ms-high-contrast:none){._3W9XC{min-height:96px}}._18aBn{height:48px;display:flex;flex:1;background-color:initial;box-sizing:border-box;width:100%}@mediaonlyscreenand(min-width:1090px){._18aBn{min-width:630px}}@mediaonlyscreenand(max-width:960px){._18aBn{max-width:720px}}@mediaonlyscreenand(max-width:1023px){._18aBn{width:100%}}._18aBn._2C0uj{width:100%;display:inline-block;box-sizing:border-box;background-color:#fff}._18aBn._2C0uj._20jkh{border-style:none;color:#002f34;position:relative;height:100%;top:0;z-index:9}@mediaonlyscreenand(max-width:1023px){._18aBn._2C0uj._20jkh{bottom:unset}}._18aBn._2C0ujul{top:calc(100%+2px)}@mediaonlyscreenand(max-width:1023px){._18aBn._2C0ujul{top:unset}}._18aBn._2C0ujulli[aria-selected=true]{background-color:#c8f8f6!important}._18aBn._2C0ujfieldset{right:0;margin:0;width:100%;left:0}@mediaonlyscreenand(max-width:1023px){._18aBn._2C0ujfieldset{position:unset;margin:unset}}._18aBn._2C0ujfieldsetdivinput{border-radius:0;height:100%;width:100%;padding:08px;line-height:normal;-webkit-appearance:none}._18aBn._2C0ujfieldsetdivinput::placeholder{color:rgba(0,47,52,.64);left:unset;line-height:normal}._18aBn._3b3oR{min-width:48px;height:48px;display:flex;cursor:pointer;background-color:#002f34;border-radius:04px4px0}._18aBn._3b3oRspan{margin:auto}@media(-ms-high-contrast:none){._18aBn._3b3oRspan{margin:12px}}._18aBn._17_5W{pointer-events:none;background-color:rgba(0,47,52,.36)}._18aBn.zYZEU{display:flex;width:100%;margin-left:16px;height:48px;box-sizing:border-box;border:2pxsolid#002f34;border-radius:4px004px}._18aBn.zYZEU:focus-within{border:1pxsolid#23e5db;outline:1pxsolid#23e5db;outline-offset:-2px}._18aBn.zYZEU._2qKv9{background-color:#fff;max-width:40%}@mediaonlyscreenand(max-width:1023px){._18aBn.zYZEU._2qKv9{display:none}}._18aBn.zYZEU._2qKv9._2gN1o{display:flex;justify-content:center;align-items:center;height:100%}._18aBn.zYZEU._2qKv9._2gN1o.F_hJM{margin:024px08px;font-size:12px;text-overflow:ellipsis;white-space:nowrap;overflow:hidden}._18aBn._3jXQ6,._18aBn._3jXQ6._3b3oR{height:40px}._18aBn._3jXQ6._3b3oRspan{padding:12px16px}._18aBn._3jXQ6.zYZEU{height:40px;border:1pxsolid#ccd5d6}._18aBn._3jXQ6.zYZEU._2C0uj{border-radius:4px004px}._18aBn._3jXQ6.zYZEU._2C0uj._20jkh{font-size:12px}._2y6yH{left:0;position:absolute;top:62px;z-index:5}._5BLBJ{width:100%}._14lZ9{float:right;height:100%;display:flex;align-items:center;margin-left:auto}._14lZ9._3kBWu{align-self:center}._14lZ9._2sx1i{width:48px;height:48px;display:flex;justify-content:center;align-items:center}._14lZ9._2sx1i._3fqyU{position:relative}._14lZ9._2sx1i._3fqyU:after{top:8px;right:8px;width:11px;z-index:1;content:"";height:11px;border-radius:50%;position:absolute;background:#23e5db}._14lZ9.J1zUM{margin:08px}._14lZ9.RgSo4{margin:0008px}._14lZ9.RgSo4._1oFFI{margin:012px020px}._14lZ9.RgSo4.Vfogk{min-width:95px;height:40px;font-size:14px;padding:015px}._14lZ9._1kVF2{font-size:14px;line-height:20px;color:#002f34;font-weight:700;text-decoration:none;padding-right:40px}._14lZ9._110yh._11r7x,._14lZ9._110yh._11r7x>div>div>span,._14lZ9._110yh._2sx1i,._14lZ9._110yh._2sx1i>div>div>span,._14lZ9._110yh._3vCh4{color:#002f34}._14lZ9._3Smpb._11r7x,._14lZ9._3Smpb._11r7x>div>div>span,._14lZ9._3Smpb._2sx1i,._14lZ9._3Smpb._2sx1i>div>div>span,._14lZ9._3Smpb._3vCh4,._14lZ9._3Smpb._3vCh4>div>div>span{color:#fff}._26unB{text-align:left;position:relative}._26unB.dZA_8:after{top:8px;right:8px;width:11px;z-index:1;content:"";height:11px;border-radius:50%;position:absolute;background:#23e5db}._1bV47{width:100%;display:flex;justify-content:center;align-items:center}._1bV47._19IhO{top:0;z-index:1;height:50px;position:absolute;opacity:.9;background:#fff}._1bV47._1fnpV{height:300px}._1bV47svg{display:block;stroke:#002f34}._2JQHf{z-index:10;display:block;position:absolute;box-sizing:border-box;background:#fff;top:53px;left:50%;width:304px;transform:translateX(-50%);box-shadow:01px4px0rgba(0,0,0,.1);border-radius:4px}._2JQHf:after{bottom:100%;left:50%;content:"";height:0;width:0;position:absolute;pointer-events:none;margin-left:-8px;border:8pxsolidtransparent;border-bottom-color:#fff}._3v_OZ{width:100%;padding:0;height:40px;display:flex;justify-content:center;align-items:center;cursor:pointer;text-align:center;box-sizing:border-box;font-size:16px;color:#002f34;border-top:1pxsolidrgba(14,4,5,.2);text-transform:uppercase;font-weight:700}._3POg8{width:100%;height:100%;display:flex;justify-content:center;align-items:center}._3POg8.CqVOM{stroke:#002f34}.ki4m2{text-align:center}.ki4m2._11WQ5{margin:32px00;font-size:14px;color:#002f34}.ki4m2._1y85Y{color:rgba(0,47,52,.64);font-size:12px}.ki4m2._2yuFQ{width:100%;height:120px;overflow:hidden;margin:24px00}.ki4m2._2yuFQimg{height:120px;height:auto}._2-GoQ{width:80px;position:relative;display:flex;align-items:center;cursor:pointer}._2-GoQ.fATHJ{justify-content:space-evenly}._2-GoQ._4BiG,._2-GoQ.zrsBV{width:35px;height:35px;border-radius:50%;border:3pxsolid#9bbbff;display:flex;justify-content:center;align-items:center;background-color:#ebf1ff;color:#3a77ff;font-weight:700;font-size:16px}._2-GoQ.zrsBV{color:#fff;background-color:#002f34;border-color:#002f34}._328CR{cursor:pointer;margin:08px00}._3nqdZ{right:32px;top:52px;width:288px;position:absolute;background:#fff;box-shadow:006px0rgba(0,0,0,.12),06px6px0rgba(0,0,0,.24);border-radius:4px}._3nqdZ:after{bottom:100%;right:16px;content:"";height:0;width:0;position:absolute;pointer-events:none;border:12pxsolidtransparent;border-bottom-color:#fff}._21nYN{position:relative;display:inline-block;width:104px;height:48px}._21nYN:after{content:"";position:absolute;width:98px;height:44px;box-shadow:02px4px-1pxrgba(0,0,0,.2),01px10px0rgba(0,0,0,.12),04px5px0rgba(0,0,0,.14);top:2px;left:3px;border-radius:24px;background:transparent;z-index:-1}._21nYN._3V9PS{width:100%;height:100%}._21nYN._2bClX{stroke:none;fill-rule:evenodd;fill-opacity:1}._21nYN._2bClX._12yOz{fill:#fff}._21nYN._2bClX._1OVwK{fill:#002f34}._21nYN._2bClX._YBz-{fill:#ffce32}._21nYN._2bClX._3uYj7{fill:#23e5db}._21nYN._2bClX.BfroU{fill:#3a77ff}._21nYN.DrSmZ{display:inline-flex;align-items:center;position:absolute;top:50%;left:50%;transform:translate(-50%,-50%);text-transform:uppercase;font-size:14px;font-weight:700;letter-spacing:.5px;color:#002f34}._21nYN.EgzsJ{display:inline-flex;margin-right:4px}._2PDEF{display:flex;align-items:center;width:100%;margin-top:2px;justify-content:flex-end;text-transform:uppercase;font-weight:700;cursor:pointer;color:#002f34}@media(-ms-high-contrast:none){._2PDEF{align-items:center}}._2PDEF._38j0w{font-size:14px;white-space:nowrap;text-overflow:ellipsis}._2PDEF.UFSX5{display:flex;align-items:center}._2L_dh{min-width:100px;position:relative}._2t8tU{text-align:center;transition:transform.5s}._2pSU8{transform:rotate(180deg)}._2Jv6i{display:none;column-count:1;width:200px;box-shadow:04px12px1pxrgba(0,0,0,.5);border-radius:4px;background-color:#fff;justify-content:space-between;padding:16px16px0}._1u-oA{display:block}._2dtTP{position:absolute;margin-top:24px;left:-24px}._2dtTP._2Jv6i:before{border-left:10pxsolidtransparent;border-right:10pxsolidtransparent;border-bottom:10pxsolid#fff;top:-10px;content:"";height:0;left:50%;margin-left:-24px;position:absolute;width:0}._3Wfs8ul{margin:0;list-style:none;padding:0}._3Wfs8li{cursor:pointer;padding:20px0}._3Wfs8lispan{font-size:14px;line-height:20px;font-weight:700;color:#002f34}._3Wfs8li._3K1Q5{float:right}._3Wfs8li._3K1Q5button{height:20px}._1SKxhimg{height:40px;object-fit:contain;margin:08px}._1ssDjimg,._38q0Himg{width:100%;object-fit:contain;border-radius:4px}._3IsqM{margin:04px}._3IsqMimg{width:98%;object-fit:contain;border-radius:4px}._2r6hS{height:48px;z-index:1}._2r6hSa{height:100%;display:block;line-height:48px}._2r6hS._2iSrO{height:40px}._2r6hS._2iSrOa{line-height:40px}._2r6hS._2iSrOa._3KvQZ{vertical-align:middle;height:32px}._2r6hS.BRINA{pointer-events:none}.hJUTK{display:block}._3aOcc{display:flex;align-items:center;position:fixed;top:0;left:0;z-index:10;margin:0auto;width:100%;height:47px;box-sizing:border-box;background-color:#002f34}._2VcXT{margin-left:auto}.OoFju{color:#fff}.QW4BB{width:37px;margin-left:auto;margin-right:20px}._3sxq9{cursor:pointer}._3w9mm{cursor:auto}/*#sourceMappingURL=desktop-Campaigns~ListingFiltersPe~OlxPledge~account~category-cover~cov19adv~cov19dec~home~item~listing~meeting~monetization~notfound~payment~profile~reProjects~settings~sitemap~usercontent.olx.5c2143e3abfe35e.css.map*/._1Ksla{width:100%;position:relative}._2ArPv{position:sticky;top:10%}._1pdyu{margin:10pxauto;max-width:970px;max-height:250px;overflow:hidden}._1pdyu>div{display:flex;justify-content:center}._8iGkX{margin:20pxauto0;max-width:970px;max-height:250px;overflow:hidden}._8iGkX>div{display:flex;justify-content:center}@mediaonlyscreenand(max-width:540px){._8iGkX{max-height:250px}}._3dJCA{position:absolute;right:-160px;margin:0auto;max-width:160px;max-height:600px}.HQj5Q{position:absolute;right:-170px;margin:0auto;width:160px;height:600px}._2nIBk{margin:10pxauto;max-width:970px;max-height:250px;overflow:hidden}._2nIBk>div{display:flex;justify-content:center}@mediaonlyscreenand(max-width:960px){._2nIBk{max-width:320px}}._2nIBk._3CG-F:empty{margin:0}._3Pmvj{position:absolute;top:76px;right:-180px;width:160px;height:600px}._3Pmvj:empty{display:none}._3sZuU{position:absolute;top:76px;left:-180px;width:160px;height:600px}.YWpZE{margin:20pxauto0;max-width:970px;max-height:250px;overflow:hidden}.YWpZE>div{display:flex;justify-content:center}@mediaonlyscreenand(max-width:540px){.YWpZE{max-height:250px}}._286FS{margin:10pxauto;max-width:970px;max-height:250px;overflow:hidden}._286FS>div{display:flex;justify-content:center}@mediaonlyscreenand(max-width:540px){._286FS{max-height:250px}}._3Szx3,._3eAbp{margin:10pxauto;max-width:300px;max-height:250px;overflow:hidden}._3Szx3>div,._3eAbp>div{display:flex;justify-content:center}._3Szx3:empty,._3eAbp:empty{display:none}@mediaonlyscreenand(max-width:540px){._3Szx3,._3eAbp{max-height:250px;margin:10pxauto36px}}._3vF1Z{position:absolute;top:10px;left:-60px;width:160px;height:600px}._3vF1Z>div{display:flex;justify-content:center}._1ymsN{margin:10pxauto;max-width:970px;max-height:250px;overflow:hidden}._1ymsN>div{display:flex;justify-content:center}@mediaonlyscreenand(max-width:540px){._1ymsN{max-height:250px}}._1_dLE{flex:1;padding-bottom:0;-ms-flex-preferred-size:auto}._1_dLE._2yGlg{background-color:#fff}._1_dLE._20mSp{background-color:#f2f4f5}._1_dLE._3JzV4{background-color:#f8f9fa}._1U6Yu{width:100%;margin:0}._2nuC5{margin:0auto;max-width:1280px}.JvlDc{filter:grayscale(1)}.rui-1rYgw{display:inline-flex;justify-content:center;align-items:center;border-style:none;background:none;outline:none;cursor:pointer;position:relative;overflow:hidden;text-decoration:none;border-radius:50%;width:40px;height:40px;padding:0}.rui-1rYgw.rui-82PI3:after,.rui-1rYgw.rui-82PI3:before{content:"";width:100%;height:100%;opacity:0;position:absolute}.rui-1rYgw.rui-82PI3:before{transition:opacity.2sease-in;background-color:#c8f8f6;z-index:-1}.rui-1rYgw.rui-82PI3:hover:before{opacity:1}.rui-1rYgw.rui-82PI3:after{background-ime:radial-gradient(circle,#fff10%,transparent10.01%);pointer-events:none;background-repeat:no-repeat;background-position:50%;transform:scale(15);transition:transform.5s,opacity.5s}.rui-1rYgw.rui-82PI3:active:after{transform:scale(0);opacity:1;transition:0s}.y7nlv{width:100%}._17tTs{display:flex;align-items:center;width:100%;margin-top:2px;text-transform:uppercase;font-weight:700;cursor:pointer;color:#002f34}@media(-ms-high-contrast:none){._17tTs{align-items:center}}._17tTs._3WCkv{font-size:14px;white-space:nowrap;text-overflow:ellipsis}._17tTs._1YKEc{display:flex;align-items:center;margin-right:16px}.ryfc9{height:492px;top:40px;left:-16px;width:100%}._2NAUI{position:absolute;top:44px;display:flex;width:100%}@mediaonlyscreenand(max-width:539px){._2NAUI{display:none}}._2NAUIli{width:100%}._2uhZ0{text-align:center;transition:transform.5s}._3K8ZG{transform:rotate(180deg)}._2um27{display:none;column-count:4;width:100%;box-shadow:04px4px0rgba(0,0,0,.1);background-color:#fff;justify-content:space-between;padding:16px16px0}._2um27._1J5By{display:inline-block;padding:08px;box-sizing:border-box;margin-bottom:16px;width:100%}._2um27._30tGA{font-size:16px;font-weight:700;color:rgba(0,47,52,.64);height:unset;line-height:unset;padding:0;margin:12px0}._2um27._30tGA:hover{color:#00a49f}._3o--i{display:block}._3JR{margin:8px0}._3JR._2fitb{padding:0;text-decoration:none;color:#002f34;font-size:14px}._3JR._2fitb:hover{color:#00a49f}._2xg5B{display:flex;align-items:center;width:calc(100%-152px)}._2xg5B._18NX_{margin:08px;white-space:nowrap;overflow:hidden;text-overflow:ellipsis;min-width:32px}._2xg5B._18NX_a{text-transform:capitalize;font-weight:400;font-size:14px;color:#002f34;text-decoration:none}.iNsaW{position:fixed;top:80px;left:50%;transform:translateX(-50%);width:auto;animation:_1RXhN.3sease;z-index:9;min-width:160px}.iNsaW.NPczX{background-color:#fff;border:none}@keyframes_1RXhN{0%{transform:translate(-50%,-120px)}to{transform:translate(-50%)}}.R3zTx{box-shadow:01px4px0rgba(0,0,0,.1);margin:004px;z-index:9}._9OCeB{box-shadow:none}._1HZl4{display:flex;margin-left:auto;margin-right:auto;max-width:1280px;position:relative}._1XEhX{height:44px}._12RKB{height:32px}._3x5OC{background-color:#f8f9fa}._1IaXM{padding:108px16px0}._2JssW{padding:68px16px0}.rui-U7OXn{font-size:14px;cursor:pointer;min-height:24px;display:flex;align-items:center}.rui-U7OXn.rui-1IzXv{width:32px;height:32px;display:flex;align-items:center;justify-content:center;position:relative}.rui-U7OXn.rui-1IzXv.rui-3JsxR{width:24px;height:24px;top:4px;left:4px;position:absolute;cursor:pointer}.rui-U7OXninput[type=checkbox]{-moz-appearance:none;position:relative;width:24px;height:24px;border:none}.rui-U7OXninput[type=checkbox].rui-2ldy7:before{border-radius:4px}.rui-U7OXninput[type=checkbox]:focus{outline:none}.rui-U7OXninput[type=checkbox]:before{display:block;width:24px;height:24px;cursor:pointer;border:2pxsolidrgba(0,47,52,.36);background:#fff;box-sizing:border-box;content:""}.rui-U7OXninput[type=checkbox]:disabled{opacity:.26}.rui-U7OXninput[type=checkbox]:disabled:not(:checked):before{border-style:dashed}.rui-U7OXninput[type=checkbox]:checked:before{background:#002f34;border:2pxsolid#002f34}.rui-U7OXn:hoverinput[type=checkbox]:not(:checked):before{border:2pxsolid#002f34}.rui-U7OXn.rui-2TKcb{cursor:pointer;padding-left:4px;font-size:14px;color:#002f34;flex:1;align-self:center}.rui-U7OXn.rui-2TKcb.rui-2teH-{color:#002f34;font-weight:700}.rui-1Azjs{height:40px;position:relative;border-style:solid;border-width:001px;box-sizing:border-box;background-color:initial;font-size:16px}.rui-1Azjs[aria-hidden=true]{display:none;visibility:hidden}.rui-1Azjsbutton[type=button]{display:none}.rui-1Azjs[aria-hidden=false]{display:block;visibility:visible}.rui-1Azjsbutton{top:5px;width:40px;padding:0;position:absolute}.rui-1Azjsbutton[type=submit]{left:0}.rui-1Azjsbutton[type=button],.rui-1Azjsbutton[type=reset]{right:0}.rui-1Azjsbutton:hover{cursor:pointer}.rui-1Azjsbutton,.rui-1Azjsinput{margin:0;color:inherit;border-width:0;font-size:inherit;vertical-align:top;line-height:inherit;background-color:initial}.rui-1Azjsbutton:focus,.rui-1Azjsinput:focus{outline:0}.rui-1Azjsbutton:before,.rui-1Azjsinput:before{font-size:24px;line-height:inherit;vertical-align:inherit}.rui-1Azjsfieldset{position:absolute;top:0;bottom:0;left:40px;padding:0;right:40px;height:100%;border-width:0;margin:5px00;box-sizing:border-box}.rui-1Azjsfieldset>div{width:100%;height:100%}.rui-1Azjsinput{width:100%;height:2em;padding:0.5em;box-sizing:border-box}.rui-1Azjsinput[placeholder]{left:0;position:absolute}.rui-1Azjsinput[placeholder]::-webkit-input-placeholder{color:inherit}.rui-1Azjsinput[placeholder]:-moz-placeholder,.rui-1Azjsinput[placeholder]::-moz-placeholder{color:inherit;opacity:1}.rui-1Azjsinput[placeholder]:-ms-input-placeholder{color:inherit}.rui-1Azjsinput[placeholder]::-ms-clear{display:none;width:0;height:0}.rui-1Azjsinput[readonly]{opacity:.5}.rui-1Azjs[role=listbox]{left:0;right:0;top:100%;padding:0;margin:0;list-style:none;position:absolute;box-shadow:01px4px0rgba(0,0,0,.1);background-color:#fff;border-color:#002f34;color:#fff;border-radius:4px}@mediaonlyscreenand(max-width:540px){.rui-1Azjs[role=listbox]{max-height:240px;overflow:auto}}.rui-1Azjs[role=listbox].rui-338gn{display:flex;min-height:64px;padding:8px08px16px;position:relative;align-items:center;box-sizing:border-box;justify-content:space-between;border-bottom:1pxsolidrgba(14,4,5,.2)}.rui-1Azjs[role=listbox].rui-338gn:last-child{border:none}.rui-1Azjs[role=listbox].rui-338gn.rui-1kyqc,.rui-1Azjs[role=listbox].rui-338gn.rui-2Tusv{float:left;width:100%}.rui-1Azjs[role=listbox].rui-338gn.rui-2Tusv{margin-bottom:8px;font-size:14px;color:#002f34}.rui-1Azjs[role=listbox].rui-338gn.rui-2Tusv.rui-2djI4{font-weight:700}.rui-1Azjs[role=listbox].rui-338gn.rui-1kyqc{text-transform:uppercase;font-size:12px;color:rgba(0,47,52,.64)}.rui-1Azjs[role=listbox].rui-338gn.rui-1UbJU{width:40px;height:40px;padding-top:8px;text-align:center;align-self:flex-end;box-sizing:border-box;color:rgba(0,47,52,.64)}.rui-1Azjs[role=listbox].rui-338gn[aria-selected=true]{color:#002f34;background-color:rgba(14,4,5,.2)}.rui-1Azjs[role=listbox].rui-338gn[aria-selected=true].rui-1kyqc{color:#002f34}.rui-1Azjs[role=listbox].rui-338gn:hover{cursor:pointer}.rui-1Azjs.rui-CUpd1input{text-transform:lowercase}@mediaonlyscreenand(max-width:1023px){.rui-1Azjs.rui-3c4NW{border:none}.rui-1Azjs.rui-3c4NWbutton[type=submit]{display:none}.rui-1Azjs.rui-3c4NWbutton[type=button]{display:block}.rui-1Azjs.rui-3c4NW[aria-hidden]{display:none;visibility:hidden}.rui-1Azjs.rui-3c4NWfieldset{display:none}.rui-1Azjs.rui-3c4NW.rui-2fxGN{top:0;left:0;right:0;bottom:0;z-index:10;margin-left:50px;position:absolute;border-style:solid;border-width:001px;background-color:#23e5db}.rui-1Azjs.rui-3c4NW.rui-2fxGNbutton[type=submit]{display:block}.rui-1Azjs.rui-3c4NW.rui-2fxGNbutton[type=button]{display:none}.rui-1Azjs.rui-3c4NW.rui-2fxGN[aria-hidden]{display:block;visibility:visible}.rui-1Azjs.rui-3c4NW.rui-2fxGNfieldset{display:block}}.rui-1gV1x{background-position:50%;background-size:cover;border-radius:50%;margin:0;position:relative;overflow:hidden}.rui-1wy7R{position:absolute;bottom:0;left:0;right:0;height:28px;background:rgba(0,47,52,.75);display:flex;justify-content:center;align-items:center;cursor:pointer}.rui-u2K6U{margin:0}.rui-6BzOY{font-weight:700}.rui-2p-vC{font-weight:400}.rui-3-n98{font-size:45px;line-height:48px}.rui-2syhU{font-size:34px;line-height:40px}.rui-3AtH-{font-size:24px;line-height:32px}.rui-xL1fl{font-size:20px;line-height:24px}.rui-VcF_8{font-size:16px;line-height:24px}.rui-2Mm6c{font-size:14px;line-height:20px}.rui-38RAu{font-size:12px;line-height:18px}.rui-1-bv7{font-size:10px;line-height:16px}.rui-2jBR-{text-transform:uppercase}.rui-1Gl_D{white-space:nowrap;overflow:hidden;text-overflow:ellipsis}._1BNQN._3Jfp2{margin:0;font-size:24px;font-weight:500;text-align:center}._1BNQN._1O1It{margin:.5em02.5em;font-size:16px;text-align:center}._1BNQN.iqQ7C{display:block;width:100%;max-width:198px;margin:0auto;height:auto}@mediaonlyscreenand(max-width:320px){._1BNQN._3Jfp2{font-size:20px}}.SCJrl{height:252px;margin:0040px;display:flex;align-items:center}.SCJrl._29XAy{position:relative}.SCJrl._2OTEh{height:252px;background-repeat:no-repeat;background-position:50%;background-size:cover;position:absolute;top:112px;left:0;right:0;z-index:1}@mediaonlyscreenand(min-width:540px)and(max-width:1024px){.SCJrl._2OTEh{position:relative;top:0;width:100%}}.SCJrl._1AJSS{top:156px}@mediaonlyscreenand(min-width:540px)and(max-width:1024px){.SCJrl._1AJSS{top:0}}.SCJrl.h0g7d{top:112px}@mediaonlyscreenand(min-width:540px)and(max-width:1024px){.SCJrl.h0g7d{top:0}}.SCJrl._2cUs_{top:0}.SCJrl._1YozS{width:100%;max-width:1240px;margin:0auto;text-transform:uppercase;text-align:left;color:#fff;font-weight:700;font-size:45px;position:relative;z-index:3}.SCJrl._1YozS._1Lp9q{margin:008px32px}.SCJrl.FLr7U{background-color:rgba(36,35,14,.2);position:absolute;top:112px;height:252px;left:0;right:0;z-index:2}.SCJrl._1wXHf{width:100vw;margin-left:-8px;margin-right:-8px;top:0}@mediaonlyscreenand(min-width:1280px){.SCJrl._1wXHf{margin-left:calc(-50vw+632px);margin-right:calc(-50vw+632px)}}.SCJrl.in0PR{position:absolute;display:flex;align-items:center;top:50%;left:52%;transform:translate(-50%,-50%)}.SCJrl.cBOAW{width:220px;font-size:20px;margin:056px00;line-height:1.1;letter-spacing:.25px;color:#fff}.SCJrl._1rvYI{height:40px;width:102px;text-transform:capitalize}._3m_mA{margin-right:20px}._3r8cu{cursor:pointer}._3wDI-{font-size:24px;margin:008px}.HWxqG{position:relative;padding-bottom:0!important;padding-top:0!important}._1HgOQ{position:relative;padding-top:4px!important;padding-bottom:80px!important}.laq-survey*{z-index:9}._18w7H{color:#fff;display:flex;justify-content:center;align-items:center;padding:1em;position:fixed;bottom:0;left:0;right:0;z-index:100}.bPs_U{margin-left:4px}._1cTvW{background:#}.YdGmu{background:#002f34}._1XwNs{height:512px;margin-bottom:40px}.JbJAl{margin-top:20px;text-align:center;display:inline-block}._2PKSnButton{cursor:not-allowed}._2Q7zG{display:block;margin:40px0;text-align:center}._2Q7zG._3fGa3{width:150px;margin-bottom:15px;height:auto}._2Q7zG._37hHD{font-weight:500;font-size:16px}._2Q7zG._3RN5i{margin-top:15px;font-size:14px}._2b8Zv{width:33%;display:flex;justify-content:space-between;align-items:flex-end;font-size:14px;line-height:20px}._2b8Zv._1qH3d{max-width:65%;overflow-wrap:break-word}._2b8Zv._1J7Tw{height:fit-content;background:#c8f8f6;padding:2px7px;border-radius:5px;font-size:12px;font-weight:700}._3OKe_{padding:016px}._2XjIp{display:flex;flex-direction:column;background-color:#fff;position:fixed;right:2.5%;bottom:5%;width:450px;height:183px;box-shadow:02px8px0rgba(0,0,0,.15);z-index:9}._15yXH{width:220px;height:28px;margin-top:32px;margin-bottom:10px}.k1hcn,._15yXH{margin-left:44px}.k1hcn{display:flex;flex-direction:row;justify-content:space-between;margin-top:36px;margin-right:44px}.YoGEb{margin-right:8px}._1Ktze{animation:_1Ktze1s}@keyframes_1Ktze{0%{right:-450px;opacity:.5}to{right:2.5%;opacity:1}}._1b0_V{animation:_1b0_V1s}@keyframes_1b0_V{0%{right:2.5%;opacity:1}to{right:-450px;opacity:.5}}._1aWUP{animation-duration:1s;animation-fill-mode:forwards;animation-iteration-count:infinite;animation-name:_2iYX-;animation-timing-function:linear;background:rgba(14,4,5,.2);background-size:900px104px;position:relative}@keyframes_2iYX-{0%{opacity:.3}50%{opacity:.7}to{opacity:.3}}._1w0LX{border-radius:4px;padding:8px}._1w0LX._2YLUA{width:100%}._1w0LX._2YLUA._1i9Bo{width:100%;height:80px;border-radius:4px}/*#sourceMappingURL=desktop-home.olx.7ba93c12bc2c6a42c1a7.css.map*/._3hLH0{height:48px;width:272px;max-height:320px;overflow:unset;z-index:6}@media(-ms-high-contrast:none){._3hLH0{min-width:272px}}._3hLH0._3B6d0{height:100%;display:flex;align-items:center;height:48px;background:#fff;padding:08px;box-sizing:border-box;border:2pxsolid#002f34;border-radius:4px}._3hLH0._3B6d0._18WJk{border:1pxsolid#ccd5d6}._3hLH0._3B6d0:focus-within{border-color:#23e5db;outline-color:#23e5db;outline-offset:-2px}._3hLH0._3B6d0._2xvhw{height:40px;width:100%;outline:0;border-width:0;font-size:16px;color:#002f34;overflow:hidden;text-overflow:ellipsis;white-space:nowrap;background:#fff;padding:00016px}._3hLH0._3B6d0._1fwdq{transition:transform.5s;position:relative}._3hLH0._3B6d0._3K9uU{transform:rotate(180deg)}._3hLH0.XV1Vg,._3hLH0._1PMKr{width:272px;box-shadow:006px0rgba(0,0,0,.12),06px6px0rgba(0,0,0,.24);position:relative;border-radius:4px}._3hLH0._1mMzE{display:none}._3hLH0.XV1Vg{height:320px;overflow-y:auto;background-color:#fff}._3hLH0._1PMKr{height:240px}._3hLH0.xcTIF{z-index:100}._3hLH0._2sUw_{width:40px;stroke:rgba(0,47,52,.36)}._3hLH0._3gTdk{cursor:pointer;text-decoration:underline}.J5Oaw{display:flex;flex-direction:column;border-bottom:1pxsolidrgba(14,4,5,.2)}.J5Oaw:last-child{border-bottom:none}.J5Oaw._394vO{display:flex;align-items:center;height:48px;padding:8px8px8px16px;box-sizing:border-box}.J5Oaw._394vOspan{color:rgba(0,47,52,.64);font-size:12px;text-transform:uppercase}.J5Oaw#N5UMOsvg{width:26px;height:26px;margin-top:2px;margin-right:8px}.J5Oaw#N5UMOsvgpath{fill:#3a77ff}._3bkgS{padding-top:24px;padding-bottom:16px}._1jtbH{display:flex;align-items:center;height:48px;cursor:pointer;padding:8px8px8px14px;box-sizing:border-box}._1jtbH:hover{background-color:#c8f8f6}._1jtbH._1k7chsvg{width:24px;height:24px;margin-top:3px;margin-right:9.6px}._1jtbH._1k7chsvgpath{fill:rgba(0,47,52,.64)}._1jtbH._1k7ch:before{width:16px}._1jtbH._3z-s0{overflow:hidden;text-overflow:ellipsis;white-space:nowrap}._1jtbH._3z-s0span{color:#002f34;font-size:14px}._1jtbH._3z-s0span._3Aqq7{text-overflow:clip;white-space:pre-wrap}._1jtbH._3z-s0._1nWq6span{color:#3a77ff;font-size:16px;font-weight:700}._1jtbH._3z-s0._1nWq6+span{color:#3a77ff}.-cMA-{width:100%;height:100%;position:relative;margin:0;overflow:scroll;background-color:#fff}.-cMA-._2HzJo{display:flex;flex-direction:column}.-cMA-._2HzJo>div:hover{background-color:#c8f8f6}._3JXP2{position:absolute;background-color:#aa133d;color:#fff}._3JXP2:after{bottom:100%;left:3%;content:"";height:0;width:0;position:absolute;pointer-events:none;border:12pxsolidtransparent;border-bottom-color:#aa133d}._3JXP2._1Ve0U{font-size:14px;padding:8px16px}._3JXP2._1Ve0U._1EY0K{position:absolute;right:8px;top:8px;cursor:pointer}._3JXP2._1Ve0U._1EY0K:before{font-size:16px}._2jpuP._1ODbZ{margin:016px;padding:16px;width:100%;display:flex;box-sizing:border-box;flex-direction:column;background-color:#fff;width:400px;overflow:hidden;border-radius:3px;position:relative;height:200px}._2jpuP.IC_2Q{z-index:1;top:10px;cursor:pointer;position:absolute;color:rgba(0,47,52,.64);right:10px}._2jpuP._3c7lV{padding:16px;display:flex;flex-direction:column;justify-content:center;height:100%}._2jpuP._3c7lV.vzZv8{color:#002f34;font-size:20px;line-height:24px;margin-bottom:12px;font-weight:700}._2jpuP._3c7lV.-MdET{color:rgba(0,47,52,.64);font-size:14px}/*#sourceMappingURL=desktop-locationOld.olx.1014bdde6718b61.css.map*/.rl3f9{margin:0-8px;padding:0;list-style:none}.AueO0li,._3mXOUli{height:266px;border-radius:4px;display:inline-block;vertical-align:top}._3mXOU._20FqS,.AueO0._20FqS{width:100%;height:auto;text-align:center}._3mXOUli{width:calc(33.%-16px)}.AueO0li{width:calc(25%-16px)}@mediaonlyscreenand(max-width:1023px){.AueO0li,._3mXOUli{width:calc(33.%-16px)}}@mediaonlyscreenand(max-width:539px){.AueO0li,._3mXOUli{width:calc(50%-16px);height:256px}}@mediaonlyscreenand(max-width:320px){.AueO0li,._3mXOUli{width:calc(100%-16px)}}.Eo34-{margin:0;padding:0;list-style:none}@mediaonlyscreenand(min-width:1024px){.Eo34-{max-width:693px}}._2vH9gli{width:calc(100%-2px);max-height:495px;border-radius:4px;display:inline-block;vertical-align:top;padding-left:0;padding-right:0}._2vH9g._20FqS{width:100%;height:auto;text-align:center;margin:0}@mediaonlyscreenand(min-width:1024px){._2vH9g{max-width:693px}}@mediaonlyscreenand(max-width:1023px){._2vH9gli{margin-top:5px;width:100%}}@mediaonlyscreenand(max-width:539px){._2vH9gli{width:100%}}@mediaonlyscreenand(max-width:319px){._2vH9gli{width:100%}}._3KneI{margin:0;padding:0;list-style:none}.CoZPP{margin-top:48px}._3-BhHli{width:calc(100%-2px);max-height:208px;border-radius:4px;display:inline-flex;vertical-align:top;padding-left:0;padding-right:0}._3-BhH._20FqS{width:100%;height:auto;text-align:center;margin:0;display:inline-block}@mediaonlyscreenand(max-width:1023px){._3-BhHli{margin:8px0}}@mediaonlyscreenand(max-width:539px){._3-BhHli{width:100%}}@mediaonlyscreenand(max-width:319px){._3-BhHli{width:100%}}.O0qGQ{width:100%;overflow:hidden;box-sizing:border-box;background:#fff;border:1pxsolidrgba(14,4,5,.2);border-radius:4px;margin:008px;height:176px;display:flex;text-decoration:none}.O0qGQ._3Zbou{flex:00232px;margin:8px}.O0qGQ._2JyJx{display:inline-block;padding:8px;width:62%}.O0qGQ._2JyJxspan{margin:008px;position:relative;z-index:2;height:16px;display:block}.O0qGQ._2JyJxspan:first-child{width:120px}.O0qGQ._2JyJxspan:last-child{width:200px}@mediaonlyscreenand(max-width:959px){.O0qGQ{height:auto}.O0qGQ._3Zbou{height:112px;flex:00112px}}.WEmHn{width:100%;overflow:hidden;box-sizing:border-box;background:#fff;border:1pxsolidrgba(14,4,5,.2);border-radius:4px;margin:10px10px10px-4px;max-height:192px;width:98%}.WEmHn._3Zbou{display:inline-block;height:192px;margin:0;padding:0;overflow:hidden;width:38%}.WEmHn._2JyJx{display:inline-block;padding:24px118px108px32px;background:#fff;width:62%}.WEmHn._2JyJxspan{margin:5px0;padding:00015px;position:relative;z-index:2}.WEmHn._2JyJxspan:first-child{width:101px;height:22px;display:block}.WEmHn._2JyJxspan:last-child{width:240.3px;height:22px;display:block}@mediaonlyscreenand(max-width:959px){.WEmHn{width:98%;margin:0auto}.WEmHn._2JyJx{padding:14px0027px}.WEmHn._2JyJxspan:first-child{display:block;width:101px;height:22px}.WEmHn._2JyJxspan:last-child{display:block;width:240.3px;height:22px}}@mediaonlyscreenand(max-width:539px){.WEmHn{margin:8px0;display:flex}.WEmHn._3Zbou{height:130px;width:130px}.WEmHn._2JyJx{padding:15px15px10px22px;flex:1}.WEmHn._2JyJxspan:first-child{display:block;width:64px;height:16px}.WEmHn._2JyJxspan:last-child{display:block;width:115px;height:16px}}._2JIfP{width:100%;overflow:hidden;box-sizing:border-box;background:#fff;border:1pxsolidrgba(14,4,5,.2);border-radius:4px;width:calc(33.%-16px);margin:8px;padding:0}._2JIfP._3Zbou{margin:0;padding:0;overflow:hidden;position:relative;height:160px}._2JIfP._2JyJx{padding:20px;box-sizing:border-box;background:#fff;height:100px}._2JIfP._2JyJxspan{height:12px;display:block}._2JIfP._2JyJxspan:first-child{width:30%;margin-bottom:12px}._2JIfP._2JyJxspan:last-child{width:100%}@mediaonlyscreenand(max-width:539px){._2JIfP{width:50%}}@mediaonlyscreenand(max-width:319px){._2JIfP{width:100%}}.n36Vb{width:100%;overflow:hidden;box-sizing:border-box;background:#fff;border:1pxsolidrgba(14,4,5,.2);border-radius:4px;width:33%;margin:7px0;padding:07px}.n36Vb._3Zbou{margin:0;padding:0;overflow:hidden;position:relative;height:400px;max-width:100%}.n36Vb._2JyJx{padding:20px;box-sizing:border-box;background:#fff}.n36Vb._2JyJxspan{height:12px;display:block}.n36Vb._2JyJxspan:first-child{width:30%;margin-bottom:12px}.n36Vb._2JyJxspan:last-child{width:100%}@mediaonlyscreenand(max-width:539px){.n36Vb._3Zbou{height:200px}}@mediaonlyscreenand(max-width:319px){.n36Vb{width:100%}}._3yyG6{animation-duration:1s;animation-fill-mode:forwards;animation-iteration-count:infinite;animation-name:_15P-C;animation-timing-function:linear;background:rgba(14,4,5,.2);background-size:900px104px;position:relative}@keyframes_15P-C{0%{opacity:.3}50%{opacity:.7}to{opacity:.3}}._2grx4{background-color:#fff;position:relative;height:160px;margin:0;overflow:hidden}._2grx4>div{display:flex;height:100%}._2grx4img{display:block;margin:auto}._2grx4img._1iGOp,._2grx4img._1ABkm{max-width:100%;max-height:100%}._2grx4img._1ABkm{width:100%}._2grx4img._3Kg_w{max-height:100%}._2grx4img._1N079{max-width:100%;max-height:100%;min-height:100%}._2grx4img._1vZ1k{width:100%;object-fit:cover}._2grx4._3Km4V{height:100%;border-radius:4px;border:1pxsolidrgba(14,4,5,.2);height:60px;width:60px}@mediaonlyscreenand(max-width:1024px){._2grx4._3Km4V{height:76px;width:76px}}._2grx4._3Km4Vimg{object-fit:cover;display:block;width:100%;height:100%}._2grx4:before{right:5px;width:50px;height:50px;bottom:-25px;line-height:35px;text-align:center;position:absolute;border-radius:50%;color:#23e5db;background-color:#fff;z-index:1}._1czk1{width:100%;height:100%;display:block;position:absolute;top:0;left:0}._1czk1._1VzGN{display:inline-block;margin:0;padding:0;overflow:hidden;width:100%;height:100%}._1czk1._1VX6L{animation-duration:1s;animation-fill-mode:forwards;animation-iteration-count:infinite;animation-name:_30iKX;animation-timing-function:linear;background:rgba(14,4,5,.2);background-size:900px104px;position:relative}@keyframes_30iKX{0%{opacity:.3}50%{opacity:.7}to{opacity:.3}}._2VDJl,.EIR5N,._8HqL0{width:50%;position:relative;border-radius:3px;box-sizing:border-box}._2VDJl._1KOFM,.EIR5N._1KOFM,._8HqL0._1KOFM{display:flex;margin-top:auto;justify-content:space-between;text-transform:uppercase;color:rgba(0,47,52,.64);font-size:10px}._2VDJl._1KOFM.zLvFQ,.EIR5N._1KOFM.zLvFQ,._8HqL0._1KOFM.zLvFQ{text-transform:uppercase;margin-left:auto}._2VDJl>a,.EIR5N>a,._8HqL0>a{position:relative;text-decoration:none;width:100%;box-sizing:border-box;background:#fff;border:1pxsolidrgba(14,4,5,.2);overflow:hidden;border-radius:4px}._2VDJl>a>figure,.EIR5N>a>figure,._8HqL0>a>figure{position:relative;background-color:#fff;padding:8px;box-sizing:border-box}._2VDJl>a>figure>img,.EIR5N>a>figure>img,._8HqL0>a>figure>img{max-width:100%}._2VDJl>a>figure:before,.EIR5N>a>figure:before,._8HqL0>a>figure:before{right:5px;width:50px;height:50px;bottom:-25px;line-height:35px;text-align:center;position:absolute;border-radius:50%;color:#23e5db;background-color:#fff}._2VDJl>a>figure._3LlRU,.EIR5N>a>figure._3LlRU,._8HqL0>a>figure._3LlRU{filter:blur(5px)}._2VDJl>a>figurenoscriptimg,.EIR5N>a>figurenoscriptimg,._8HqL0>a>figurenoscriptimg{z-index:1}._2VDJl>a.IKo3_._89yzn,._2VDJl>a.IKo3_._2tW1I,._2VDJl>a.IKo3_label,.EIR5N>a.IKo3_._89yzn,.EIR5N>a.IKo3_._2tW1I,.EIR5N>a.IKo3_label,._8HqL0>a.IKo3_._89yzn,._8HqL0>a.IKo3_._2tW1I,._8HqL0>a.IKo3_label{margin:5px0;position:relative;z-index:2}._2VDJl>a.IKo3_._89yzn,.EIR5N>a.IKo3_._89yzn,._8HqL0>a.IKo3_._89yzn{margin-top:0}._2VDJl>a.IKo3_._2tW1I,.EIR5N>a.IKo3_._2tW1I,._8HqL0>a.IKo3_._2tW1I{color:rgba(0,47,52,.64);font-size:14px}._2VDJl>a.IKo3_._2TVI3,.EIR5N>a.IKo3_._2TVI3,._8HqL0>a.IKo3_._2TVI3{color:#002f34;font-size:14px;margin:2px00;text-overflow:ellipsis;overflow:hidden;white-space:nowrap}._2VDJl>a.IKo3_._89yzn,.EIR5N>a.IKo3_._89yzn,._8HqL0>a.IKo3_._89yzn{direction:ltr;font-weight:700;margin-bottom:0;white-space:nowrap;overflow:hidden;text-overflow:ellipsis;color:#002f34;font-size:20px}._2VDJl>a.IKo3_._2awF2,.EIR5N>a.IKo3_._2awF2,._8HqL0>a.IKo3_._2awF2{right:0;bottom:0;cursor:pointer;position:absolute;color:rgba(0,47,52,.36)}._2VDJl>a.IKo3_._2awF2:before,.EIR5N>a.IKo3_._2awF2:before,._8HqL0>a.IKo3_._2awF2:before{width:40px;height:40px;line-height:40px;text-align:center}._2VDJl>a._1X63c>div,.EIR5N>a._1X63c>div,._8HqL0>a._1X63c>div{border-left:5pxsolid#23e5db}._2VDJl>a._1X63c>divlabel,.EIR5N>a._1X63c>divlabel,._8HqL0>a._1X63c>divlabel{color:#23e5db;text-transform:uppercase}._2VDJl>a._1X63c>divlabel>span,.EIR5N>a._1X63c>divlabel>span,._8HqL0>a._1X63c>divlabel>span{font-size:12px}._2VDJl>a._1X63c>divi,.EIR5N>a._1X63c>divi,._8HqL0>a._1X63c>divi{color:#23e5db}._2VDJl>a._3pSnB>div,.EIR5N>a._3pSnB>div,._8HqL0>a._3pSnB>div{border-left:5pxsolid#23e5db}._2VDJl>a._3pSnB>divlabel,.EIR5N>a._3pSnB>divlabel,._8HqL0>a._3pSnB>divlabel{color:#23e5db;text-transform:uppercase}._2VDJl>a._3pSnB>divlabel>span,.EIR5N>a._3pSnB>divlabel>span,._8HqL0>a._3pSnB>divlabel>span{font-size:12px}._2VDJl>a._3pSnB>divi,.EIR5N>a._3pSnB>divi,._8HqL0>a._3pSnB>divi{color:#23e5db}._2VDJl>a._2ku78>div,.EIR5N>a._2ku78>div,._8HqL0>a._2ku78>div{border-left:5pxsolid#23e5db}._2VDJl>a._2ku78>divlabel,.EIR5N>a._2ku78>divlabel,._8HqL0>a._2ku78>divlabel{color:#23e5db;text-transform:uppercase}._2VDJl>a._2ku78>divlabel>span,.EIR5N>a._2ku78>divlabel>span,._8HqL0>a._2ku78>divlabel>span{font-size:12px}._2VDJl>a._2ku78>divi,.EIR5N>a._2ku78>divi,._8HqL0>a._2ku78>divi{color:#23e5db}._2VDJl>a._3NtM8>div,.EIR5N>a._3NtM8>div,._8HqL0>a._3NtM8>div{border-left:5pxsolid#002f34}._2VDJl>a._3NtM8>divlabel,.EIR5N>a._3NtM8>divlabel,._8HqL0>a._3NtM8>divlabel{color:#002f34;text-transform:uppercase}._2VDJl>a._3NtM8>divlabel>span,.EIR5N>a._3NtM8>divlabel>span,._8HqL0>a._3NtM8>divlabel>span{font-size:12px}._2VDJl>a._3NtM8>divi,.EIR5N>a._3NtM8>divi,._8HqL0>a._3NtM8>divi{color:#002f34}._2VDJl>a._2KosO>div,.EIR5N>a._2KosO>div,._8HqL0>a._2KosO>div{border-left:5pxsolid#ff2800}._2VDJl>a._2KosO>divlabel,.EIR5N>a._2KosO>divlabel,._8HqL0>a._2KosO>divlabel{color:#ff2800;text-transform:uppercase}._2VDJl>a._2KosO>divlabel>span,.EIR5N>a._2KosO>divlabel>span,._8HqL0>a._2KosO>divlabel>span{font-size:12px}._2VDJl>a._2KosO>divi,.EIR5N>a._2KosO>divi,._8HqL0>a._2KosO>divi{color:#ff2800}._2VDJl>a.W801C>div,.EIR5N>a.W801C>div,._8HqL0>a.W801C>div{border-left:5pxsolid#ff2800}._2VDJl>a.W801C>divlabel,.EIR5N>a.W801C>divlabel,._8HqL0>a.W801C>divlabel{color:#ff2800;text-transform:uppercase}._2VDJl>a.W801C>divlabel>span,.EIR5N>a.W801C>divlabel>span,._8HqL0>a.W801C>divlabel>span{font-size:12px}._2VDJl>a.W801C>divi,.EIR5N>a.W801C>divi,._8HqL0>a.W801C>divi{color:#ff2800}._2VDJl>a._2PWYV>div,.EIR5N>a._2PWYV>div,._8HqL0>a._2PWYV>div{border-left:5pxsolid#ff2800}._2VDJl>a._2PWYV>divlabel,.EIR5N>a._2PWYV>divlabel,._8HqL0>a._2PWYV>divlabel{color:#ff2800;text-transform:uppercase}._2VDJl>a._2PWYV>divlabel>span,.EIR5N>a._2PWYV>divlabel>span,._8HqL0>a._2PWYV>divlabel>span{font-size:12px}._2VDJl>a._2PWYV>divi,.EIR5N>a._2PWYV>divi,._8HqL0>a._2PWYV>divi{color:#ff2800}._2VDJl>a.gfr3_>div,.EIR5N>a.gfr3_>div,._8HqL0>a.gfr3_>div{border-left:5pxsolidrgba(0,47,52,.64)}._2VDJl>a.gfr3_>divlabel,.EIR5N>a.gfr3_>divlabel,._8HqL0>a.gfr3_>divlabel{color:rgba(0,47,52,.64);text-transform:uppercase}._2VDJl>a.gfr3_>divlabel>span,.EIR5N>a.gfr3_>divlabel>span,._8HqL0>a.gfr3_>divlabel>span{font-size:12px}._2VDJl>a.gfr3_>divi,.EIR5N>a.gfr3_>divi,._8HqL0>a.gfr3_>divi{color:rgba(0,47,52,.64)}._2VDJl.tjgMj,.EIR5N.tjgMj,._8HqL0.tjgMj{color:rgba(0,47,52,.64);display:inline-block;max-width:70%;overflow:hidden;text-overflow:ellipsis;white-space:nowrap}._2LYp_{position:absolute;z-index:7;top:0;right:0}._3XcQh{position:absolute;right:12px;top:138px;z-index:7}._3XcQh._3ZcW4{width:30px!important;z-index:0}._3XcQh._3apgb{top:96px}._3XcQh.j2681{width:30px;height:30px}.EIR5N{margin:8px;padding:0;text-align:left}.EIR5N>a{display:flex;flex-direction:column;width:100%;height:100%}.EIR5N>a>figure{margin:0;overflow:hidden}.EIR5N>a.IKo3_{display:flex;flex-direction:column;flex:1;position:relative;padding:8px16px}@mediaonlyscreenand(max-width:539px){.EIR5N>a.IKo3_._1KOFM.zLvFQ{display:none}}.EIR5N>a.IKo3_>label{font-size:14px}.EIR5N>a.IKo3_>label:before{margin-top:-5px;font-size:16px}.EIR5N>a.IKo3_._2Vp0i{display:initial}.EIR5N>a.IKo3_._2TVI3,.EIR5N>a.IKo3_._89yzn,.EIR5N>a.IKo3_._2tW1I,.EIR5N>a.IKo3_label{text-align:left;display:block}.EIR5N>a.IKo3_._2tW1I{font-weight:400;white-space:nowrap;overflow:hidden;text-overflow:ellipsis;margin-top:5px}.EIR5N>a.IKo3_._2tW1I._8WFAM{margin-top:8px}.EIR5N>a.IKo3_._2k0a5{list-style:none;margin-top:10px;height:24px;padding:9px8px015px;border-top:1pxsolidrgba(14,4,5,.2);color:rgba(0,47,52,.36);display:flex;align-items:center;justify-content:flex-start}.EIR5N>a.IKo3_._2k0a5>div{display:flex;align-items:center;margin-right:10px;height:100%}.EIR5N>a.IKo3_._2k0a5>div:last-child{margin-right:0}.EIR5N>a.IKo3_._2k0a5>divi{margin-right:5px}.EIR5N>a.IKo3_._2k0a5>divspan{font-size:12px}.EIR5N>a.IKo3_._2k0a5>div._2qq2Si:before{font-size:24px}.EIR5N>a.fhlkh>div,.EIR5N>a._2ku78>div{position:static}.EIR5N>a.fhlkh>divlabel,.EIR5N>a._2ku78>divlabel{position:absolute;top:8px;left:8px;text-transform:uppercase;padding:0}.EIR5N>a.fhlkh>divlabel>span,.EIR5N>a._2ku78>divlabel>span{font-size:10px;padding:4px8px;font-weight:700;display:block}.EIR5N>a._2ku78>div{border-left:5pxsolid#23e5db}.EIR5N>a._2ku78>divlabel>span{background-color:#23e5db;color:#002f34}.EIR5N>a.fhlkh>div{border-left:5pxsolid#ffce32}.EIR5N>a.fhlkh>divlabel>span{background-color:#ffce32;color:#002f34}._2-msB{position:absolute;bottom:90px;right:20px;z-index:7}._2-msB.j2681{width:40px;height:40px}._2VDJl{margin:7px0;padding:07px}._2VDJl>a{width:100%;display:inline-block}._2VDJl>a>figure{margin:0;overflow:hidden;max-height:357px;height:357px}._2VDJl>a.IKo3_{display:flex;flex-direction:column;position:relative;padding:8px16px}._2VDJl>a.IKo3_>label{font-size:14px}._2VDJl>a.IKo3_>label:before{margin-top:-5px;font-size:16px}._2VDJl>a.IKo3_._2TVI3,._2VDJl>a.IKo3_._89yzn,._2VDJl>a.IKo3_._2tW1I,._2VDJl>a.IKo3_label{display:block}._2VDJl>a.IKo3_._2tW1I{margin:4px08px;hyphens:auto;font-weight:400;word-wrap:break-word;overflow-wrap:break-word;white-space:nowrap;overflow:hidden;text-overflow:ellipsis}._2VDJl>a.IKo3_._2tW1I._8WFAM{margin-top:8px}._2VDJl>a.IKo3_._2k0a5{list-style:none;margin:10px00;height:24px;padding:9px8px015px;border-top:1pxsolidrgba(14,4,5,.2);color:rgba(0,47,52,.36)}._2VDJl>a.IKo3_._2k0a5li{float:left;margin-right:10px}._2VDJl>a.IKo3_._2k0a5li:last-child{margin-right:0}._2VDJl>a.IKo3_._2k0a5lii{margin-right:5px}._2VDJl>a.IKo3_._2k0a5lispan{font-size:12px}._2VDJl>a.IKo3_._2k0a5li._2-ug5i:before{font-size:20px}._2VDJl>a.IKo3_._2k0a5li._2qq2Si:before{font-size:24px}._2VDJl>a.fhlkh>div{position:static;border-left:5pxsolid#ffce32}._2VDJl>a.fhlkh>divlabel{text-transform:uppercase;position:absolute;top:8px;left:8px;padding:0}._2VDJl>a.fhlkh>divlabel>span{background-color:#ffce32;color:#002f34;font-size:10px;padding:5px12px;font-weight:700}._3DPAp{position:absolute;bottom:-16px;left:10px;z-index:7}._3DPAp.j2681{width:30px;height:30px}._8HqL0{margin:7px0;padding:07px}._8HqL0>a{width:100%;height:187px;display:flex}._8HqL0>a>figure{width:272px;min-width:272px;order:1;height:185px}._8HqL0>a>figure>img{margin:auto}._8HqL0>a.IKo3_{display:flex;flex-direction:column;order:2;overflow:hidden;width:100%;padding:24px16px8px}._8HqL0>a.IKo3_>:first-child{max-width:calc(100%-40px)}._8HqL0>a.IKo3_._1KOFM{margin-top:auto}._8HqL0>a.IKo3_._2tW1I{hyphens:auto;word-wrap:break-word;overflow-wrap:break-word;white-space:nowrap;overflow:hidden;text-overflow:ellipsis;display:block}._8HqL0>a.IKo3_._89yzn{display:block}._8HqL0>a.IKo3_._2k0a5{list-style:none;margin:10px00;height:24px;padding:9px8px015px;border-top:1pxsolidrgba(14,4,5,.2);color:rgba(0,47,52,.36)}._8HqL0>a.IKo3_._2k0a5li{float:left;margin-right:10px}._8HqL0>a.IKo3_._2k0a5li:last-child{margin-right:0}._8HqL0>a.IKo3_._2k0a5lii{margin-right:5px}._8HqL0>a.IKo3_._2k0a5lispan{font-size:12px}._8HqL0>a.IKo3_._2k0a5li._2-ug5i:before{font-size:20px}._8HqL0>a.IKo3_._2k0a5li._2qq2Si:before{font-size:24px}._8HqL0>a.fhlkh>div{position:relative;border-left:5pxsolid#ffce32}._8HqL0>a.fhlkh>divlabel{display:block;text-transform:uppercase}._8HqL0>a.fhlkh>divlabel>span{background-color:#ffce32;color:#002f34;font-size:12px;padding:3px9px2px}@mediaonlyscreenand(max-width:1024px){.EIR5N{width:25%}}@mediaonlyscreenand(min-width:540px){._2VDJl.IKo3_{height:85px}}@mediaonlyscreenand(min-width:1024px){._2VDJl._1KOFM,.EIR5N._1KOFM,._8HqL0._1KOFM{font-size:10px}._2VDJl._8WFAM{max-width:95%;margin:8px00}._8HqL0>a.IKo3_._2TVI3{margin:8px00}._8HqL0>a.IKo3_._2tW1I{margin:16px00}._8HqL0>a.IKo3_._2tW1I._8WFAM{max-width:95%;margin:8px00}.tjgMj{text-transform:uppercase}.EIR5N.EIR5N{height:266px}.EIR5N{width:25%}.EIR5N.tjgMj{max-width:75%}._2VDJl>a.IKo3_._2tW1I{margin:2px010px}}@mediaonlyscreenand(max-width:539px){._2VDJla.IKo3_._2tW1I,.EIR5Na.IKo3_._2tW1I,._8HqL0a.IKo3_._2tW1I{font-size:12px}._8HqL0._1KOFM{text-transform:uppercase;font-size:10px}._8HqL0.tjgMj{max-width:60%}._8HqL0a{height:130px}._8HqL0afigure{height:130px;width:130px;min-width:130px}._8HqL0a.IKo3_{padding:8px16px}._8HqL0a.IKo3_._2tW1I._8WFAM{margin-top:8px}._2VDJl{display:flex;position:relative;flex-direction:column}._2VDJlafigure{height:200px}._2VDJla.IKo3_{padding:8px16px;height:85px;display:flex;flex-direction:column}._2VDJla.IKo3_._2tW1I{margin:2px012px}._2VDJla.IKo3_._2tW1I._8WFAM{margin-top:8px}.EIR5N.EIR5N{height:264px}.EIR5N.EIR5N.tjgMj{max-width:unset}.EIR5N.EIR5N.IKo3_{padding:8px}.tjgMj{font-size:10px}}._2a_T5{margin:8px;padding:8px;cursor:pointer;list-style:none;overflow:hidden;position:relative;box-sizing:border-box;background:#3a77ff}@mediaonlyscreenand(min-width:1024px){._2a_T5{padding:16px}}._2a_T5._1n-u_{z-index:2;width:100%;height:100%;display:flex;position:relative;align-items:center;box-sizing:border-box;text-align:center;flex-direction:column}._2a_T5._3Nhk_{color:#fff;flex-grow:1;display:flex;flex-direction:column;overflow:hidden;margin-bottom:20px}._2a_T5._2zEP4{color:#fff;font-size:16px;margin:0}._2a_T5._12BFu{font-size:14px;line-height:normal;margin-bottom:0}._2a_T5._2hlCK{flex-shrink:0;width:100%}._2a_T5._31Uon._12BFu{margin-top:20px}._2a_T5._1lhga,._2a_T5._33Zty{margin:5px0}._2a_T5._1lhga._12BFu,._2a_T5._33Zty._12BFu{margin-top:8px}._2a_T5._33Zty._1n-u_{padding:16px40px}._2a_T5._33Zty._1QYgi{top:-70%}._2a_T5._1lhga._1n-u_{padding:40px}.hBPzz{height:302px}li._2c5-L._2c5-L{width:calc(100%-16px);height:100%;margin:8px;display:block}li._2c5-L._2c5-L>div{display:flex;justify-content:left;box-sizing:border-box;width:100%;font-size:16px}._38sB6{padding:008px;border-bottom:2pxsolidrgba(0,47,52,.36)}.Jqarr{margin:64px00}._2l-js{padding:004px}._3JenI{padding:008px;border-bottom:2pxsolidrgba(0,47,52,.36)}._9GMcv{margin:64px00}/*#sourceMappingURL=desktop-itemViewListingOld.olx.4058f635e93f98ec1319.css.map*/Login/DaftarJualSemuaKategoriMobilBekasMotorBekasPropertiHandphoneJasa&LowonganKerjaTV&Audio,VideoMobilMobilBekasAksesoriAudioMobilSparePartVelgdanBanTruk&KendaraanKomersialPropertiDijual:Rumah&ApartemenDisewakan:Rumah&ApartemenTanahIndekosDijual:BangunanKomersilDisewakan:BangunanKomersilMotorMotorBekasAksesorisHelmSparePartJasa&LowonganKerjaLowonganCariPekerjaanJasaElektronik&GadgetHandphoneTabletAksesorisHP&TabletFotografiElektronikRumahTanggaGames&ConsoleKomputerLampuTV&Audio,VideoHobi&OlahraAlat-alatMusikOlahraSepeda&AksesorisHandicraftsBarangAntikBuku&MajalahKoleksiMainanHobiMusik&FilmHewanPeliharaanRumahTanggaMakanan&MinumanMebelDekorasiRumahKonstruksidanTamanJamLampuPerlengkapanRumahLain-lainKeperluanPribadiFashionWanitaFashionPriaJamTanganPakaianOlahraPerhiasanMakeUp&ParfumTerapi&PengobatanPerawatanNutrisi&SuplemenLainnyaPerlengkapanBayi&AnakPakaianPerlengkapanBayiPerlengkapanIbuBayiBoneka&MainanAnakBukuAnak-anakStrollerLain-lainKantor&IndustriPeralatanKantorPerlengkapanUsahaMesin&KeperluanIndustriStationeryLain-lainRekomendasibaruHighlightRp90.000.0002016#[OlxAutos]DaihatsuAyla1.0XM/T2016Abu-AbuKebonJeruk,JakartaBarat3hariyanglaluHighlightRp3.500.000Laptop2in1MerkHPPilion11-ab128TUBanjarmasinTimur,BanjarmasinKota15JunHighlightRp347.000.0002016HONDACIVIC1.5ESTURBOSEDAN2016MATICSemarangTimur,SemarangKota14JunHighlightRp322.100.0002022[MobilBaru]PromoKreditHONDACITYHATCHBACK2022TERBARUBuahbatu(Margacinta),BandungKota7JunRp50.000GordenMinimalisGordynKordenHordengBlindsCurtainWallaperDindingJatinegara,JakartaTimurHariiniInginmelihatbarangAndadisini?Hasilkanuangtambahansekarangdenganmenjualbarang-barangdikomunitasAnda.AyomulaiberjualandiOLX,semuajadicepatdanmudah.PasangIklanRp50.000JualgordenRumahmewah&GordynApartemenFreesurveyHordengCurtainJatinegara,JakartaTimur3hariyanglaluRp50.000GordenMinimalisGordynKordenHordengBlindsCurtainWallaperDindingMatraman,JakartaTimurHariiniRp32.000.0003KT-3KM-186m2SewaApartemenTheElement3+1BRPrivateLiftUnfurnishSetiaBudi,JakartaSelatanHariiniRp50.000TiraiGordenCustomFreeSurveyBayarDitempatHordengGordynCurtainMatraman,JakartaTimurHariiniRp60.000SEPESIALISGORDENCUSTUMBAHANINFORTDANLOKAL#40Jatinegara,JakartaTimurHariiniRp22.000.0002KT-2KM-98m2SewaApartemenTheElement2BedroomsLantaiRendahSetiaBudi,JakartaSelatanHariiniRp385.000CUSTUMGORDENTERBAIKBAHANINFORT/LOKAL#42Jatinegara,JakartaTimurHariiniRp999.000.0003KT-2KM-65m2RumahMewahBergayaEropaTerbaruSelangkahkeTolSerpongSHMSetiaBudi,JakartaSelatanHariiniRp24.000.0002KT-2KM-90m2SewaApartemenTheElementHarmonyTower2BRFurnishedSetiaBudi,JakartaSelatanHariiniRp15.500.000.000TanahMurahdijualdiMampangPrapatanJakartaSelatanMampangPrapatan,JakartaSelatanHariiniRp25.000.0002KT-2KM-89m2SewaApartemenTheElementatKawasanEpicentrumRasunaSetiaBudi,JakartaSelatanHariiniRp385.000SEPESIALISGORDENCUSTUMBAHANINFORTDANLOKAL#50Matraman,JakartaTimurHariiniRp500.000MejariaskayujatiJatinegara,JakartaTimurHariiniHighlightRp200.000JASABUANG:GRAL/TANAH/SAMPAH/URUGAN/TEBANGPOHON/DUMPTRUKSawahan,SurabayaKota9MeiHighlightRp399.000.0002018KM.15rbHondaCRV1.5TurboNonPrestigeATHitam2018BlackonBlackTebet,JakartaSelatan6AprmuatlainnyaKategoriPopulerMobilBekasRumah&ApartemenMotorBekasHandphonePencarianPopulerTabletFashionWanitaFashionPriaFurnitureOLXIndonesiaOLXKarirOLXNewsJualMobilInstanPusatKreditdanGadaiLayananInspeksiMobilOLXTentangOLXGroupPusatBantuanPetaSitusKebijakanPrivasiTipsAmanIkutikamiIklanBarisGratisdiIndonesia.©2006-2022OLXNegara-negaralainIndia-Pakistan-SouthAfricawindow.__APP={props:{"lang":"id","region":"mea","location":{"pathname":"\u002F","search":"","hash":"","action":"POP","key":"iyn4vc","query":{},"hostname":""},"environment":"production","appName":"panamera-web","config":{"plugins":["LQ"],"environment":"production"},"platformType":"pwaDesktop"},states:{"myads":{"openRemoveAfterMarkAsSold":false,"items":[]},"items":{"collections":{"items#\u002Fapi\u002Frelevance\u002Ffeed#latitude=-6.&location=&longitude=106.":["8","3","5","2","8","4","9","6","3","1","8","4","1","0","5","9","7","4","4","4"]},"isFetching":{"items#\u002Fapi\u002Frelevance\u002Ffeed#latitude=-6.&location=&longitude=106.":false},"isError":{"items#\u002Fapi\u002Frelevance\u002Ffeed#latitude=-6.&location=&longitude=106.":false},"collectionMetadata":{"items#\u002Fapi\u002Frelevance\u002Ffeed#latitude=-6.&location=&longitude=106.":{"total":,"filters":[],"feed_version":"1.0","applied_filters":[],"modified_filters":{},"sections":[],"suggested_sections":[],"total_suggested_ads":0,"nextPeUrl":"latitude=-6.&location=&pe=1&longitude=106."}},"elements":{"4":{"id":"4","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"display":"active","translated_display":"Aktif","fls":{"hot":false,"new":false}},"category_id":"228","forites":{"count":152,"count_label":"99+","count_label_next":"99+","count_label_prev":"99+"},"has_phone_param":false,"description":"KamiUD.BORNEOsiapmelayanisemuakebutuhanuntuk:\n\n-PEMBERSIHANGRAL&SAMPAHPROYEK\n-PENGIRIMANURUGAN\u002FTIMBUNAN\n-MOBILISASIALATKERJAPROYEK\n-PEMOTONGANPOHONDANTANAMANLIAR\n\nUntukjasa(PERRIT)mulai:\n\n•ArmadaTrukBakKayuRp.200rb\n(kapasitasmuatan:2m3)\n\n•ArmadaDumpTrukRp.300rb\n(kapasitasmuatan:4m3+)\n\n\nNote:\n¤HARGAJASAakanmenyesuaikanlokasi\n¤SudahtermasukArmadadanTena\n¤melayaniareaSurabaya,Sidoarjo,Gresik\n\nMonggoditungguorderannya\nKepuasanandaPrioritasKami\n\nTerimakasih\n\nSalamHormat\n《BORNEOJAYA》","created_at":"2022-05-09T07:46:56+07:00","inspection_info":null,"title":"JASABUANG:GRAL\u002FTANAH\u002FSAMPAH\u002FURUGAN\u002FTEBANGPOHON\u002FDUMPTRUK","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp200.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":{"adId":"4","currentProduct":{"packeId":}},"imes":[{"external_id":"61h2009k95fp3-ID","height":607,"id":"21","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F61h2009k95fp3-ID\u002Fime","width":1080},{"external_id":"mpbwws6g4a6x-ID","height":614,"id":"22","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmpbwws6g4a6x-ID\u002Fime","width":1080},{"external_id":"whzrfq0w5gy43-ID","height":809,"id":"23","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fwhzrfq0w5gy43-ID\u002Fime","width":1080},{"external_id":"as9tby6hud71-ID","height":809,"id":"24","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fas9tby6hud71-ID\u002Fime","width":1080},{"external_id":"p3qld7atv59j1-ID","height":607,"id":"25","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fp3qld7atv59j1-ID\u002Fime","width":1080},{"external_id":"2izjgj4f7pik2-ID","height":734,"id":"26","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F2izjgj4f7pik2-ID\u002Fime","width":1080},{"external_id":"bgy81fz076ns1-ID","height":705,"id":"27","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbgy81fz076ns1-ID\u002Fime","width":1080},{"external_id":"dcitfrngeojv-ID","height":810,"id":"28","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdcitfrngeojv-ID\u002Fime","width":1080},{"external_id":"v5xh0jky4huj1-ID","height":1080,"id":"29","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fv5xh0jky4huj1-ID\u002Fime","width":810},{"external_id":"kiaqa9fsikja1-ID","height":607,"id":"30","url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fkiaqa9fsikja1-ID\u002Fime","width":1080}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JawaTimur","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"SurabayaKota","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Sawahan"},"deal_price":null,"business_platform":"CLA","main_info":null,"display_date":"2022-05-09T00:46:56+0000","user_id":"","installment":null,"created_at_first":"2019-01-07T09:32:38+07:00","locations":[{"lat":-7.263,"lon":112.721,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"JasaLainnya","value":"jasa-lowongan-kerja-jasa-jasa-lainnya","key_name":"Tipe","formatted_value":"JasaLainnya"}]},"4":{"id":"4","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4835","forites":{"count":4,"count_label":"4","count_label_next":"5","count_label_prev":"3"},"has_phone_param":false,"description":"Mejarias\nBahankayujati\nKondisimasihsangatbaik\nPxLxT95x55x185cm\n\nLokasiCipinangjaya\nTidakmenerimapengiriman\nCeklangsungdilokasi","created_at":"2022-06-27T06:55:23+07:00","inspection_info":null,"packe_id":null,"title":"Mejariaskayujati","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp500.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"26","external_id":"cgamn8v5bhcu2-ID","width":498,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fcgamn8v5bhcu2-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Jatinegara"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:55:23+0000","user_id":"","installment":null,"created_at_first":"2021-12-23T07:37:10+07:00","locations":[{"lat":-6.23,"lon":106.882,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Bekas","value":"bekas","key_name":"Kondisi","formatted_value":"Bekas"}]},"8":{"id":"8","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"5160","forites":{"count":1,"count_label":"1","count_label_next":"2"},"has_phone_param":false,"description":"Condition:Brandnewfurnishedwithhigh-qualityfurniture.\nFacility:24-hourCCTV,businesscenter,concierge,fitnesscenter,yoga\u002Faerobicsroom,internet,library,outdoorswimmingpoolforadultandchildren,outdoordanindoorchildrenplayground,massespa,whirlpool,basementparking,commonlift,andprivatelift.\nAdditionalInfo:\n\nDevelopedbySINARMASLAND,thetrusted,thelargestandthemostdiversifiedpropertydeveloperinIndonesiaandownsover10.000hectaresofstrategicLandBank.\nBuiltbyHYUNDAIEngineering,anInternationalandReliableContractor.\nLocatedperfectlyinanintegratedandgreensuperblockRasunaEpicentrum,withexcellentaccessthatcaterstoyourhighmobileactivities.\nTheElementsheexcellentaccesstoandfrom:RasunaSaid,Imperium\u002FKPK,CasablancaandGalunggungMenteng.\nLocatedjustbesideEpicentrumWalk,itissoeasytoenjoyCinemaXXI,famousrestaurantandcafe,farmersmarket,BanksandATM,joggingtrack,riverwalk,sportsclub(eliteclub).\nSurroundedbymanyimportantbuildings(Embassies,Offices,Malls,Hotels,Hospitals,SchoolsandUniversities)\nTheElementsisequippedwithhigh-qualitymaterial:doubleGlassfaçade,spaciousbalconyineveryunit,foldingwindowbalcony.","created_at":"2022-06-27T06:57:30+07:00","inspection_info":null,"packe_id":null,"title":"SewaApartemenTheElement2BedroomsLantaiRendah","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp22.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"96","external_id":"f2sp0u4gv7h-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ff2sp0u4gv7h-ID\u002Fime"},{"id":"97","external_id":"jg1ixtcvurus2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjg1ixtcvurus2-ID\u002Fime"},{"id":"98","external_id":"jp1pqpc73vet1-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjp1pqpc73vet1-ID\u002Fime"},{"id":"99","external_id":"nxsn6jd6zujh2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fnxsn6jd6zujh2-ID\u002Fime"},{"id":"00","external_id":"vh8576h6yis51-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fvh8576h6yis51-ID\u002Fime"},{"id":"01","external_id":"kgoqnytuy99m1-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fkgoqnytuy99m1-ID\u002Fime"},{"id":"02","external_id":"siuc6gmpy4q01-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fsiuc6gmpy4q01-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SetiaBudi"},"deal_price":null,"business_platform":null,"main_info":"2KT-2KM-98m2","display_date":"2022-06-26T23:57:29+0000","user_id":"","installment":null,"created_at_first":"2021-12-27T22:41:45+07:00","locations":[{"lat":-6.219,"lon":106.832,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Apartemen","value":"apartemen","key_name":"Tipe","formatted_value":"Apartemen"},{"type":"single","key":"p_sqr_building","value_name":"98","value":"98","key_name":"Luasbangunan","formatted_value":"98"},{"type":"single","key":"p_sqr_land","value_name":"98","value":"98","key_name":"Luastanah","formatted_value":"98"},{"type":"single","key":"p_bedroom","value_name":"2","value":"2","key_name":"Kamartidur","formatted_value":"2"},{"type":"single","key":"p_bathroom","value_name":"2","value":"2","key_name":"KamarMandi","formatted_value":"2"},{"type":"single","key":"p_floor","value_name":"8","value":"8","key_name":"Lantai","formatted_value":"8"},{"type":"multi","key":"p_facility","values":[{"value":"ac"},{"value":"carport"},{"value":"fireextenguisher"},{"value":"garasi"},{"value":"garden"},{"value":"gordyn"},{"value":"microwe"},{"value":"oven"},{"value":"pam"},{"value":"refrigerator"},{"value":"stove"},{"value":"swimmingpool"},{"value":"telephone"},{"value":"waterheater"}],"key_name":"Fasilitas"},{"type":"single","key":"p_certificate","value_name":"Lainnya(PPJB,Girik,Adat,dll)","value":"lainnyappjbgirikadatdll","key_name":"Sertifikasi","formatted_value":"Lainnya(PPJB,Girik,Adat,dll)"},{"type":"single","key":"p_alamat","value_name":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","key_name":"Alamatlokasi","formatted_value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta"}]},"6":{"id":"6","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"5160","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"Condition:Brandnewfurnishedwithhigh-qualityfurniture.\nFacility:24-hourCCTV,businesscenter,concierge,fitnesscenter,yoga\u002Faerobicsroom,internet,library,outdoorswimmingpoolforadultandchildren,outdoordanindoorchildrenplayground,massespa,whirlpool,basementparking,commonlift,andprivatelift.\nAdditionalInfo:\n\nDevelopedbySINARMASLAND,thetrusted,thelargestandthemostdiversifiedpropertydeveloperinIndonesiaandownsover10.000hectaresofstrategicLandBank.\nBuiltbyHYUNDAIEngineering,anInternationalandReliableContractor.\nLocatedperfectlyinanintegratedandgreensuperblockRasunaEpicentrum,withexcellentaccessthatcaterstoyourhighmobileactivities.\nTheElementsheexcellentaccesstoandfrom:RasunaSaid,Imperium\u002FKPK,CasablancaandGalunggungMenteng.\nLocatedjustbesideEpicentrumWalk,itissoeasytoenjoyCinemaXXI,famousrestaurantandcafe,farmersmarket,BanksandATM,joggingtrack,riverwalk,sportsclub(eliteclub).\nSurroundedbymanyimportantbuildings(Embassies,Offices,Malls,Hotels,Hospitals,SchoolsandUniversities)\nTheElementsisequippedwithhigh-qualitymaterial:doubleGlassfaçade,spaciousbalconyineveryunit,foldingwindowbalcony.","created_at":"2022-06-27T06:57:56+07:00","inspection_info":null,"packe_id":null,"title":"SewaApartemenTheElement3+1BRPrivateLiftUnfurnish","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp32.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"52","external_id":"7fedw0castbb3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7fedw0castbb3-ID\u002Fime"},{"id":"53","external_id":"jvbt0wuizy062-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjvbt0wuizy062-ID\u002Fime"},{"id":"54","external_id":"sksik0iajjdl2-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fsksik0iajjdl2-ID\u002Fime"},{"id":"55","external_id":"3aj6k1xl9tdc2-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F3aj6k1xl9tdc2-ID\u002Fime"},{"id":"56","external_id":"1xfv9egqlep5-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1xfv9egqlep5-ID\u002Fime"},{"id":"57","external_id":"qukf2brg3dk62-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqukf2brg3dk62-ID\u002Fime"},{"id":"58","external_id":"vezeypko52po3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fvezeypko52po3-ID\u002Fime"},{"id":"59","external_id":"pkokfvj3b3so3-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fpkokfvj3b3so3-ID\u002Fime"},{"id":"60","external_id":"jv044y0o3cwm2-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjv044y0o3cwm2-ID\u002Fime"},{"id":"61","external_id":"b6dwhs603e4i-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fb6dwhs603e4i-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SetiaBudi"},"deal_price":null,"business_platform":null,"main_info":"3KT-3KM-186m2","display_date":"2022-06-26T23:57:55+0000","user_id":"","installment":null,"created_at_first":"2021-12-27T22:48:42+07:00","locations":[{"lat":-6.219,"lon":106.832,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Apartemen","value":"apartemen","key_name":"Tipe","formatted_value":"Apartemen"},{"type":"single","key":"p_sqr_building","value_name":"186","value":"186","key_name":"Luasbangunan","formatted_value":"186"},{"type":"single","key":"p_sqr_land","value_name":"186","value":"186","key_name":"Luastanah","formatted_value":"186"},{"type":"single","key":"p_bedroom","value_name":"3","value":"3","key_name":"Kamartidur","formatted_value":"3"},{"type":"single","key":"p_bathroom","value_name":"3","value":"3","key_name":"KamarMandi","formatted_value":"3"},{"type":"single","key":"p_floor","value_name":"20","value":"20","key_name":"Lantai","formatted_value":"20"},{"type":"multi","key":"p_facility","values":[{"value":"ac"},{"value":"carport"},{"value":"fireextenguisher"},{"value":"garasi"},{"value":"garden"},{"value":"gordyn"},{"value":"microwe"},{"value":"oven"},{"value":"pam"},{"value":"refrigerator"},{"value":"stove"},{"value":"swimmingpool"},{"value":"telephone"},{"value":"waterheater"}],"key_name":"Fasilitas"},{"type":"single","key":"p_certificate","value_name":"Lainnya(PPJB,Girik,Adat,dll)","value":"lainnyappjbgirikadatdll","key_name":"Sertifikasi","formatted_value":"Lainnya(PPJB,Girik,Adat,dll)"},{"type":"single","key":"p_alamat","value_name":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","key_name":"Alamatlokasi","formatted_value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta"}]},"0":{"id":"0","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"5160","forites":{"count":1,"count_label":"1","count_label_next":"2"},"has_phone_param":false,"description":"Condition:Brandnewfurnishedwithhigh-qualityfurniture.\nFacility:24-hourCCTV,businesscenter,concierge,fitnesscenter,yoga\u002Faerobicsroom,internet,library,outdoorswimmingpoolforadultandchildren,outdoordanindoorchildrenplayground,massespa,whirlpool,basementparking,commonlift,andprivatelift.\nAdditionalInfo:\n\nDevelopedbySINARMASLAND,thetrusted,thelargestandthemostdiversifiedpropertydeveloperinIndonesiaandownsover10.000hectaresofstrategicLandBank.\nBuiltbyHYUNDAIEngineering,anInternationalandReliableContractor.\nLocatedperfectlyinanintegratedandgreensuperblockRasunaEpicentrum,withexcellentaccessthatcaterstoyourhighmobileactivities.\nTheElementsheexcellentaccesstoandfrom:RasunaSaid,Imperium\u002FKPK,CasablancaandGalunggungMenteng.\nLocatedjustbesideEpicentrumWalk,itissoeasytoenjoyCinemaXXI,famousrestaurantandcafe,farmersmarket,BanksandATM,joggingtrack,riverwalk,sportsclub(eliteclub).\nSurroundedbymanyimportantbuildings(Embassies,Offices,Malls,Hotels,Hospitals,SchoolsandUniversities)\nTheElementsisequippedwithhigh-qualitymaterial:doubleGlassfaçade,spaciousbalconyineveryunit,foldingwindowbalcony.","created_at":"2022-06-27T06:56:06+07:00","inspection_info":null,"packe_id":null,"title":"SewaApartemenTheElementHarmonyTower2BRFurnished","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp24.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"64","external_id":"i7vetom52x352-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fi7vetom52x352-ID\u002Fime"},{"id":"65","external_id":"uic0xoways5z1-ID","width":1080,"height":613,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fuic0xoways5z1-ID\u002Fime"},{"id":"66","external_id":"ycqodw54kwbu1-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fycqodw54kwbu1-ID\u002Fime"},{"id":"67","external_id":"ht5mw3nbl0ps-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fht5mw3nbl0ps-ID\u002Fime"},{"id":"68","external_id":"22acybc0600j-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F22acybc0600j-ID\u002Fime"},{"id":"69","external_id":"fi9yfhyx8tck2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ffi9yfhyx8tck2-ID\u002Fime"},{"id":"70","external_id":"1m9hs3p35b291-ID","width":1080,"height":787,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1m9hs3p35b291-ID\u002Fime"},{"id":"71","external_id":"iewbxy4x8jic2-ID","width":1080,"height":737,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fiewbxy4x8jic2-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SetiaBudi"},"deal_price":null,"business_platform":null,"main_info":"2KT-2KM-90m2","display_date":"2022-06-26T23:56:05+0000","user_id":"","installment":null,"created_at_first":"2021-12-27T23:30:25+07:00","locations":[{"lat":-6.219,"lon":106.832,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Apartemen","value":"apartemen","key_name":"Tipe","formatted_value":"Apartemen"},{"type":"single","key":"p_sqr_building","value_name":"90","value":"90","key_name":"Luasbangunan","formatted_value":"90"},{"type":"single","key":"p_sqr_land","value_name":"90","value":"90","key_name":"Luastanah","formatted_value":"90"},{"type":"single","key":"p_bedroom","value_name":"2","value":"2","key_name":"Kamartidur","formatted_value":"2"},{"type":"single","key":"p_bathroom","value_name":"2","value":"2","key_name":"KamarMandi","formatted_value":"2"},{"type":"single","key":"p_floor","value_name":"27","value":"27","key_name":"Lantai","formatted_value":"27"},{"type":"multi","key":"p_facility","values":[{"value":"ac"},{"value":"carport"},{"value":"fireextenguisher"},{"value":"garasi"},{"value":"garden"},{"value":"gordyn"},{"value":"microwe"},{"value":"oven"},{"value":"pam"},{"value":"refrigerator"},{"value":"stove"},{"value":"swimmingpool"},{"value":"telephone"},{"value":"waterheater"}],"key_name":"Fasilitas"},{"type":"single","key":"p_certificate","value_name":"Lainnya(PPJB,Girik,Adat,dll)","value":"lainnyappjbgirikadatdll","key_name":"Sertifikasi","formatted_value":"Lainnya(PPJB,Girik,Adat,dll)"},{"type":"single","key":"p_alamat","value_name":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta","key_name":"Alamatlokasi","formatted_value":"KawasanRasunaEpicentrum,Jl.EpicentrumBoulevardBarat,KaretKuningan,RT.2\u002FRW.5,KaretKuningan,KotaJakartaSelatan,DaerahKhususIbukotaJakarta"}]},"9":{"id":"9","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"5160","forites":{"count":2,"count_label":"2","count_label_next":"3","count_label_prev":"1"},"has_phone_param":false,"description":"Tersediabanyakunituntukdijualdandisewakan,menerimajugajasatitipunituntukdijualdandisewakan.","created_at":"2022-06-27T06:55:37+07:00","inspection_info":null,"packe_id":null,"title":"SewaApartemenTheElementatKawasanEpicentrumRasuna","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp25.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"53","external_id":"gte2wvw2bq1n2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fgte2wvw2bq1n2-ID\u002Fime"},{"id":"54","external_id":"ltb5yt060ij12-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fltb5yt060ij12-ID\u002Fime"},{"id":"55","external_id":"tojw42q2rgdz2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ftojw42q2rgdz2-ID\u002Fime"},{"id":"56","external_id":"qsrzkykxu3yc3-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqsrzkykxu3yc3-ID\u002Fime"},{"id":"57","external_id":"lfwj6s4u52z32-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Flfwj6s4u52z32-ID\u002Fime"},{"id":"58","external_id":"n2gn3vbozfnu2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fn2gn3vbozfnu2-ID\u002Fime"},{"id":"59","external_id":"vod2zv8wqlx31-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fvod2zv8wqlx31-ID\u002Fime"},{"id":"60","external_id":"b1xf4zptyz3h2-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fb1xf4zptyz3h2-ID\u002Fime"},{"id":"61","external_id":"t30x28h2s1wc1-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ft30x28h2s1wc1-ID\u002Fime"},{"id":"62","external_id":"qd1nk9or057h3-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqd1nk9or057h3-ID\u002Fime"},{"id":"63","external_id":"vmfhje5pqcpb3-ID","width":1080,"height":607,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fvmfhje5pqcpb3-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SetiaBudi"},"deal_price":null,"business_platform":null,"main_info":"2KT-2KM-89m2","display_date":"2022-06-26T23:55:35+0000","user_id":"","installment":null,"created_at_first":"2022-03-28T05:56:49+07:00","locations":[{"lat":-6.219,"lon":106.832,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Apartemen","value":"apartemen","key_name":"Tipe","formatted_value":"Apartemen"},{"type":"single","key":"p_sqr_building","value_name":"89","value":"89","key_name":"Luasbangunan","formatted_value":"89"},{"type":"single","key":"p_sqr_land","value_name":"89","value":"89","key_name":"Luastanah","formatted_value":"89"},{"type":"single","key":"p_bedroom","value_name":"2","value":"2","key_name":"Kamartidur","formatted_value":"2"},{"type":"single","key":"p_bathroom","value_name":"2","value":"2","key_name":"KamarMandi","formatted_value":"2"},{"type":"single","key":"p_floor","value_name":"8","value":"8","key_name":"Lantai","formatted_value":"8"},{"type":"multi","key":"p_facility","values":[{"value":"ac"},{"value":"carport"},{"value":"fireextenguisher"},{"value":"garasi"},{"value":"garden"},{"value":"gordyn"},{"value":"microwe"},{"value":"oven"},{"value":"pam"},{"value":"refrigerator"},{"value":"stove"},{"value":"swimmingpool"},{"value":"telephone"},{"value":"waterheater"}],"key_name":"Fasilitas"},{"type":"single","key":"p_certificate","value_name":"Lainnya(PPJB,Girik,Adat,dll)","value":"lainnyappjbgirikadatdll","key_name":"Sertifikasi","formatted_value":"Lainnya(PPJB,Girik,Adat,dll)"},{"type":"single","key":"p_alamat","value_name":"JalanRasunaEpicentrumKuninganSetiabudiJakartaSelatan","value":"JalanRasunaEpicentrumKuninganSetiabudiJakartaSelatan","key_name":"Alamatlokasi","formatted_value":"JalanRasunaEpicentrumKuninganSetiabudiJakartaSelatan"}]},"4":{"id":"4","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"198","forites":{"count":11,"count_label":"11","count_label_next":"12","count_label_prev":"10"},"vasTs":["verified_seller"],"has_phone_param":false,"description":"[PLATBGANJILDEPOK]\n\nHondaCrv1.5TurboNonPrestigeATHitam2018SuperAntikLowKM15rbRecordAUTHORIZED!!\n#Engine1.5VtecTurboAutoECOMode\n#PajakPanjangBulan9-2022\n#ServisRutinTerakhirKM14.269Bulan2-2022\n#Tangan1daribaruPribadi\n-KeylessStartEngine\n-ElectricLeatherseatThirdrowseaters\n-ACDigitalNanoeION\n-Cruisecontrol&Audiosteer\n-ElectricRetractMirror\n-InteriorHeadunitOEMTouchscreen+GPS+Camera,Woodenpanel\n-EksteriorUpgradeBigWheelsR20\",HeadlampProjectorwithLED,Foglamp,Spoiler,Sensorparking,SportDoubleMuffler\n-BukuServiceBukuManualRemoteAudioKunciserep\n-KFVkool\n\nOTRKredit:399jt\nOTRCash:435jtNEGO\n\nSimulasipaketkredit:\nTDP=ask\nAngs=ask\n\nMelayanipembeliansecaracash,kreditataupuntukartambahunitlamaAnda.\n\nKenapaharusdiFocusMotor?\n-Jaminanunitbukanbekastabrakan.\n-Jaminanunitbukanbekasbanjir.\n-Jaminankeabsahansurat-suratnya.\n-Adagaransimesinselama1tahun*\n-Paketkreditbisamenyesuaikan.\n-Hargasemuaunitmasihbisanegowajar.\n-Tersediaratusanunitfastmoving.\n\n*syaratdanketentuanberlaku\n\nSilahkandatangkeshowroom,cekunit,testdrive,negoharga,deal,bawapulangunitdandijamintidakakanmengecewakan.\n\nAlamatshowroom:\nFocusMotor\nBursaOtomotifManggaDuaSquareLantaiLGlotM21\nJl.GunungSahariRayaNo.1JakartaUtara\n\nOperasional:SETIAPHARIpukul09.30-17.30\n\nUntukinfolebihlanjutsilahkanhubungi:\nNickoFocusMotor\nChat\u002FTelp\u002FWA\nNomorkontaktersediadiiklan\n\nTerimakasih","created_at":"2022-06-07T09:53:42+07:00","inspection_info":null,"title":"KM.15rbHondaCRV1.5TurboNonPrestigeATHitam2018BlackonBlack","car_body_type":"suv","partner_id":null,"user_type":"Regular","price":{"value":{"raw":0,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp399.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"53","external_id":"logrzv438rju2-ID","width":1024,"height":576,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Flogrzv438rju2-ID\u002Fime"},{"id":"54","external_id":"w8vygq7fhhy72-ID","width":1024,"height":575,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fw8vygq7fhhy72-ID\u002Fime"},{"id":"55","external_id":"tqungjahh7b62-ID","width":1024,"height":576,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ftqungjahh7b62-ID\u002Fime"},{"id":"56","external_id":"7cul1dkzwgkf2-ID","width":1024,"height":576,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7cul1dkzwgkf2-ID\u002Fime"},{"id":"57","external_id":"l65xx9wa0mvl-ID","width":1024,"height":576,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fl65xx9wa0mvl-ID\u002Fime"},{"id":"58","external_id":"36k5k4t9dj5y2-ID","width":1024,"height":575,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F36k5k4t9dj5y2-ID\u002Fime"},{"id":"59","external_id":"dorjozbp909c-ID","width":1024,"height":575,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdorjozbp909c-ID\u002Fime"},{"id":"60","external_id":"bo3hm4svrzx7-ID","width":1280,"height":719,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbo3hm4svrzx7-ID\u002Fime"},{"id":"61","external_id":"e33o6j8fjbt11-ID","width":1024,"height":576,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fe33o6j8fjbt11-ID\u002Fime"},{"id":"62","external_id":"0ijcnnlw8dai-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F0ijcnnlw8dai-ID\u002Fime"},{"id":"63","external_id":"qbbrxcx3yvod3-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqbbrxcx3yvod3-ID\u002Fime"},{"id":"64","external_id":"7lpjrb6d5xir-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7lpjrb6d5xir-ID\u002Fime"},{"id":"65","external_id":"2gzrg658sp8s3-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F2gzrg658sp8s3-ID\u002Fime"},{"id":"66","external_id":"fpralu69wq4y-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ffpralu69wq4y-ID\u002Fime"},{"id":"67","external_id":"dijikvvmmnih1-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdijikvvmmnih1-ID\u002Fime"},{"id":"68","external_id":"80jq9txkvv6n-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F80jq9txkvv6n-ID\u002Fime"},{"id":"69","external_id":"4cae5n1n2ao33-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F4cae5n1n2ao33-ID\u002Fime"},{"id":"70","external_id":"61yywg7ezyuw2-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F61yywg7ezyuw2-ID\u002Fime"},{"id":"71","external_id":"pgmaekdosey7-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fpgmaekdosey7-ID\u002Fime"},{"id":"72","external_id":"2w0hl4in2at92-ID","width":1280,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F2w0hl4in2at92-ID\u002Fime"}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":true,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Tebet"},"deal_price":null,"business_platform":null,"main_info":"2018","display_date":"2022-04-06T04:39:01+0000","user_id":"","installment":null,"created_at_first":"2022-04-06T11:39:01+07:00","locations":[{"lat":-6.231,"lon":106.847,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"make","value_name":"Honda","value":"mobil-bekas-honda","key_name":"Merek","formatted_value":"Honda"},{"type":"single","key":"m_tipe_variant","value_name":"1.5TurboBensin","value":"cr-v-1.5-turbo-bensin","key_name":"Varian","formatted_value":"1.5TurboBensin"},{"type":"single","key":"m_tipe","value_name":"CR-V","value":"mobil-bekas-honda-cr-v","key_name":"Model","formatted_value":"CR-V"},{"type":"single","key":"m_year","value_name":"2018","value":"2018","key_name":"Tahun","formatted_value":"2018"},{"type":"single","key":"milee","value_name":"10.000-15.000","value":"15","key_name":"Jaraktempuh","formatted_value":"10.000-15.000km"},{"type":"single","key":"m_fuel","value_name":"Bensin","value":"bensin","key_name":"Tipebahanbakar","formatted_value":"Bensin"},{"type":"single","key":"m_color","value_name":"Hitam","value":"hitam","key_name":"Warna","formatted_value":"Hitam"},{"type":"single","key":"m_transmission","value_name":"Automatic","value":"automatic","key_name":"Transmisi","formatted_value":"Automatic"},{"type":"single","key":"m_body","value_name":"SUV","value":"suv","key_name":"Tipebodi","formatted_value":"SUV"},{"type":"single","key":"m_engine_capacity","value_name":"\u003E1.000-1.500cc","value":"1000-to-1500","key_name":"Kapasitasmesin","formatted_value":"\u003E1.000-1.500cc"},{"type":"single","key":"m_seller_type","value_name":"Diler","value":"seller-type-diler","key_name":"TipePenjual","formatted_value":"Diler"},{"type":"single","key":"m_exchange","value_name":"BursaMobilManggaDuaSquare","value":"bm-mangga-dua-square","key_name":"NamaBursaMobil","formatted_value":"BursaMobilManggaDuaSquare"}]},"4":{"id":"4","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"Kamibergerakdibidangpengerjaandekorasiinteriorberupagordyn,lukisdinding,wallpaper,blinds,kasanyamukuntukrumahtangga,rumahsakit,kantor,apartment,danhotel.\n\nTersediabanyakbahanpilihandaridalamdanluarnegeri,segalamacammodeldariclasic,modernhinggatrendminimalis.\n\nHargamulaidari\nRp.50.000\u002Fm²s\u002FdRp.95.000\u002Fm²(untukbahanlokal)\nRp.100.000\u002Fm²s\u002FdRp.300.000\u002Fm²(untukbahanimport)\nRp.350.000\u002Fm²s\u002FdRp.800.000\u002Fm²(untukgordrnmodelBlinds)\n\nSedangkanUntukWallpaper\n95.000\u002Fm2-190.000\u002Fm2(WallpaperPremiumKatalog)\n350.000\u002Fm2(WallpaperCustomDesain)\n\nKamiakanmengirimkanstaffsurveyorygprofesionaluntukmengunjungianda,denganmembawasamplebahansekaligusmelakukanpengukuranditempatanda.\nGRATISbiayasurvey,pengukurandanpemasangan(Jabodetabek) \nMoreinfosilahkanhubungikontakpersonkami\n\n\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\n(Lx3)x(T+30cm)\nKet:\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntuklipatanatas15cmdanlipatanbawah15cm\nExample: \nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterpersegi\nJaditotalpemakayanbahanuntukjendelaukuran1mx2madalah6,9meterpersegi(m2).","created_at":"2022-06-24T21:33:33+07:00","inspection_info":null,"packe_id":null,"title":"JualgordenRumahmewah&GordynApartemenFreesurveyHordengCurtain","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp50.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"83","external_id":"x7vcvvhhmto1-ID","width":1060,"height":1060,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fx7vcvvhhmto1-ID\u002Fime"},{"id":"84","external_id":"k56p6k8yz0uv1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fk56p6k8yz0uv1-ID\u002Fime"},{"id":"85","external_id":"y67dpq9poshd1-ID","width":720,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fy67dpq9poshd1-ID\u002Fime"},{"id":"86","external_id":"bksmw5jea0vr1-ID","width":941,"height":941,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbksmw5jea0vr1-ID\u002Fime"},{"id":"87","external_id":"o2ipmgu7dvku1-ID","width":719,"height":719,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fo2ipmgu7dvku1-ID\u002Fime"},{"id":"88","external_id":"zs456ixn3v9h1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fzs456ixn3v9h1-ID\u002Fime"},{"id":"89","external_id":"rhmbpqennreb1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Frhmbpqennreb1-ID\u002Fime"},{"id":"90","external_id":"qybevm63t0fk1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqybevm63t0fk1-ID\u002Fime"},{"id":"91","external_id":"muvi3ptx5hgz-ID","width":716,"height":716,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmuvi3ptx5hgz-ID\u002Fime"},{"id":"92","external_id":"36wsdrweismw1-ID","width":1059,"height":1059,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F36wsdrweismw1-ID\u002Fime"},{"id":"93","external_id":"8w3baex99ygd3-ID","width":960,"height":960,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F8w3baex99ygd3-ID\u002Fime"},{"id":"94","external_id":"ziry8wivet2a1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fziry8wivet2a1-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Jatinegara"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-24T14:33:33+0000","user_id":"6","installment":null,"created_at_first":"2022-04-12T22:04:22+07:00","locations":[{"lat":-6.23,"lon":106.882,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"3":{"id":"3","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"Kamibergerakdibidangpengerjaandekorasiinteriorberupagordyn,lukisdinding,wallpaper,blinds,kasanyamukuntukrumahtangga,rumahsakit,kantor,apartment,danhotel.\n\nTersediabanyakbahanpilihandaridalamdanluarnegeri,segalamacammodeldariclasic,modernhinggatrendminimalis.\n\nHargamulaidari\nRp.50.000\u002Fm²s\u002FdRp.95.000\u002Fm²(untukbahanlokal)\nRp.100.000\u002Fm²s\u002FdRp.300.000\u002Fm²(untukbahanimport)\nRp.350.000\u002Fm²s\u002FdRp.800.000\u002Fm²(untukgordrnmodelBlinds)\n\nSedangkanUntukWallpaper\n95.000\u002Fm2-190.000\u002Fm2(WallpaperPremiumKatalog)\n350.000\u002Fm2(WallpaperCustomDesain)\n\nKamiakanmengirimkanstaffsurveyorygprofesionaluntukmengunjungianda,denganmembawasamplebahansekaligusmelakukanpengukuranditempatanda.\nGRATISbiayasurvey,pengukurandanpemasangan(Jabodetabek) \nMoreinfosilahkanhubungikontakpersonkami\n\n\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\n(Lx3)x(T+30cm)\nKet:\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntuklipatanatas15cmdanlipatanbawah15cm\nExample: \nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterpersegi\nJaditotalpemakayanbahanuntukjendelaukuran1mx2madalah6,9meterpersegi(m2).","created_at":"2022-06-27T06:57:45+07:00","inspection_info":null,"packe_id":null,"title":"TiraiGordenCustomFreeSurveyBayarDitempatHordengGordynCurtain","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp50.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"77","external_id":"c05rbmyttcsg1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fc05rbmyttcsg1-ID\u002Fime"},{"id":"78","external_id":"ak7s31uxw6lg-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fak7s31uxw6lg-ID\u002Fime"},{"id":"80","external_id":"7ik5pfrqqgfp1-ID","width":1080,"height":1350,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7ik5pfrqqgfp1-ID\u002Fime"},{"id":"82","external_id":"h1om4kdqpwli1-ID","width":1080,"height":788,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fh1om4kdqpwli1-ID\u002Fime"},{"id":"85","external_id":"tp87cjpw7pz63-ID","width":1080,"height":886,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ftp87cjpw7pz63-ID\u002Fime"},{"id":"86","external_id":"zoevdnye5yk43-ID","width":1080,"height":1133,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fzoevdnye5yk43-ID\u002Fime"},{"id":"87","external_id":"hadtzlgw6e3o3-ID","width":727,"height":727,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fhadtzlgw6e3o3-ID\u002Fime"},{"id":"88","external_id":"yo78mr9a23lc2-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fyo78mr9a23lc2-ID\u002Fime"},{"id":"89","external_id":"id4ccmkok1m72-ID","width":486,"height":486,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fid4ccmkok1m72-ID\u002Fime"},{"id":"90","external_id":"wqy08y7jf0tm1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fwqy08y7jf0tm1-ID\u002Fime"},{"id":"91","external_id":"evext57lomio2-ID","width":883,"height":883,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fevext57lomio2-ID\u002Fime"},{"id":"92","external_id":"68t8klonv4ap-ID","width":1080,"height":1346,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F68t8klonv4ap-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Matraman"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:57:45+0000","user_id":"6","installment":null,"created_at_first":"2022-04-12T22:04:30+07:00","locations":[{"lat":-6.203,"lon":106.862,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"8":{"id":"8","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"198","forites":{"count":1,"count_label":"1","count_label_next":"2"},"vasTs":["inspected_car"],"has_phone_param":false,"description":"OLXAutosMeruya--\n\nDaihatsuAyla1.0XM\u002FT2016Abu-Abu\n\nHargaCreditRp90,000,000\nHargaCashRpRp94,000,000\n\n\nFREEBENEFIT(keuntungan)tambahanjikaandamembelimobildiOLXAutos-Jual-Beli-TukarTambah\nPromoJuni:\nBelimobilsekarang,dapatkancashbacksaldodigital300Ribu!\n*Syarat&KetentuanBerlaku\n\nKREDITMUDAH&MURAHDIOLXAUTOSMERUYATDPTERENDAHMULAIDARI10%\nBUNGATERENDAHMULAIDARI6.7%\n\nPROMOAUTOAPPROVEDPENGAJUANKREDITBEBASBICHECKINGJOININCOME=3XANGSURANRUMAHMILIKSENDIRI\u002FKELUARGA\n\n-OLXAUTOSMERUYAPUSATTUKARTAMBAH-\nPROMOTRADEINSUKA-SUKA\t\t\nDISCTDPS\u002FD3JT\nGARANSIHARGAMOBILKAMITAWARLEBIHTINGGI\nTERIMASEMUAMEREKMOBIL&SEMUATAHUNMOBIL\n*Syaratdanketentuanberlaku\n\nSpesifikasiKendaraan:\n-STNKdanBPKBAsli(AtasnamaPerorangan)\n-PajakJuni2022\n-PlatNomorGenap\t\n-WarnaAbu-Abu\n-Odometer71,740km\n-InteriorOriginalFabricModel\n-HeadUnitOriginaldanTerawat\n-VelgdanBanOriginal\n-Kaki-kakiTerawat\n-BebasBanjir\n-BebasTabrak\nUntukmeyakinkananda,kamiberikanfreeTestdrive\nTidaksempatdatangketoko?NikmatifasilitasHOMETESTDRIVEdarikami.\n1.Tidakadabiayadimuka\n2.Jarakmaksimum30KM*\n3.DapatkanHadiahLangsungsouveniruntukpelayananHOMETESTDRIVE.\n\nJl.RadenSalehBlok:10No.25,RT.5\u002FRW.1,\nMeruyaUtara,Kec.Kembangan,\nKotaJakartaBarat\nDaerahKhususIbukotaJakarta.\n\nAtaubisakunjungiCabangkamiyanglaindi\n\nCBDMallCiledug.(ParkirBasementB1)\nJl.HOSCokroaminotoNo.93,RT.001\u002FRW.001,KarangTengah,Kec.KarangTengah,KotaTangerang,Banten.\n\nSugeng-SalesExecutive\nOLXAutospusatnyaMobilBekasBerkualitas\nMobillulusinspeksidanbergaransi","created_at":"2022-06-20T19:09:44+07:00","inspection_info":{"inspection_id":"4d613a13-13b5-45d6-aeb4ecc7","group":"INTERNAL"},"title":"#[OlxAutos]DaihatsuAyla1.0XM\u002FT2016Abu-Abu","car_body_type":"compact-city-car","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp90.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"37","external_id":"i0ph02so3zkl2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fi0ph02so3zkl2-ID\u002Fime"},{"id":"83","external_id":"juuxv7v0ngwu-ID","width":1024,"height":768,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjuuxv7v0ngwu-ID\u002Fime"},{"id":"39","external_id":"0za9qvp6dqch3-ID","width":1024,"height":1024,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F0za9qvp6dqch3-ID\u002Fime"},{"id":"40","external_id":"eoxy8jtpl7d21-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Feoxy8jtpl7d21-ID\u002Fime"},{"id":"41","external_id":"stuyox9gl7go3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fstuyox9gl7go3-ID\u002Fime"},{"id":"42","external_id":"diejt6coxy1g1-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdiejt6coxy1g1-ID\u002Fime"},{"id":"43","extOLX Pusatnya Nge-Dealernal_id":"77mept77a39h2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F77mept77a39h2-ID\u002Fime"},{"id":"44","external_id":"ob4nf2wxoo3k3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fob4nf2wxoo3k3-ID\u002Fime"},{"id":"45","external_id":"5lfrfq6vir1c1-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5lfrfq6vir1c1-ID\u002Fime"},{"id":"46","external_id":"gfz6my3ed89e-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fgfz6my3ed89e-ID\u002Fime"},{"id":"47","external_id":"dydx2lq7auud-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdydx2lq7auud-ID\u002Fime"},{"id":"48","external_id":"qmwad98klvck2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqmwad98klvck2-ID\u002Fime"},{"id":"49","external_id":"mljj0uxrdj1l3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmljj0uxrdj1l3-ID\u002Fime"},{"id":"50","external_id":"rb8j1shy3dc92-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Frb8j1shy3dc92-ID\u002Fime"},{"id":"51","external_id":"bfghe8iyjpj52-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbfghe8iyjpj52-ID\u002Fime"},{"id":"52","external_id":"efsq727zqmi53-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fefsq727zqmi53-ID\u002Fime"},{"id":"53","external_id":"ym12wmv0aw833-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fym12wmv0aw833-ID\u002Fime"}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaBarat","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"KebonJeruk"},"deal_price":null,"business_platform":null,"main_info":"2016","display_date":"2022-06-24T16:52:32+0000","user_id":"2","installment":null,"created_at_first":"2022-05-19T12:23:02+07:00","locations":[{"lat":-6.183,"lon":106.764,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"make","value_name":"Daihatsu","value":"mobil-bekas-daihatsu","key_name":"Merek","formatted_value":"Daihatsu"},{"type":"single","key":"m_tipe","value_name":"Ayla","value":"mobil-bekas-daihatsu-ayla","key_name":"Model","formatted_value":"Ayla"},{"type":"single","key":"m_tipe_variant","value_name":"1.0XBensin","value":"daihatsu-ayla--x","key_name":"Varian","formatted_value":"1.0XBensin"},{"type":"single","key":"m_year","value_name":"2016","value":"2016","key_name":"Tahun","formatted_value":"2016"},{"type":"single","key":"milee","value_name":"70.000-75.000","value":"75","key_name":"Jaraktempuh","formatted_value":"70.000-75.000km"},{"type":"single","key":"m_fuel","value_name":"Bensin","value":"bensin","key_name":"Tipebahanbakar","formatted_value":"Bensin"},{"type":"single","key":"m_color","value_name":"Abu-abu","value":"abu-abu","key_name":"Warna","formatted_value":"Abu-abu"},{"type":"single","key":"m_transmission","value_name":"Manual","value":"manual","key_name":"Transmisi","formatted_value":"Manual"},{"type":"single","key":"m_body","value_name":"Compact&CityCar","value":"compact-city-car","key_name":"Tipebodi","formatted_value":"Compact&CityCar"},{"type":"single","key":"m_engine_capacity","value_name":"\u003C1.000cc","value":"lt-1000","key_name":"Kapasitasmesin","formatted_value":"\u003C1.000cc"}]},"2":{"id":"2","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"198","forites":{"count":0,"count_label_next":"1"},"vasTs":["verified_seller"],"has_phone_param":false,"description":"IklanMobilBarudenganbadge\"MobilBaru\"OLXtelahdiverifikasiolehOLXIndonesia.\n\nPromoKreditHONDACITYHATCHBACK2022TERBARU!\n\nKalauadastockygbaruknpmestibelistocklama?\n\nFeebooking5jt\nDp55jtangsuran6jt\nREAL\n\n(SIAPDIADUUNTUKMEMBUKTIKANDPSIAPAYGTERMURAHATAUPUNHITUNGANPALINGMURAHUNTUKYANGSERIUS)\n\nTersediaHitunganDpmurahatauangsuranmurahuntuktipeHondalainnya,seperti\n-HondaBrio\n-HondaJazz\n-HondaMobilio\n-HondaBRV\n-HondaHRV\n-HondaCRV\n-HondaCivic\n-HondaAccord\n\nNote:\n#DirumahAja\n#DatiaWa\n-BookingFeetransferkeRekresmi\n-Databisadibantu\n-HitunganFleksibelsesuaikebutuhan\n(SilahkanJapriviaWAuntukmintahitungan)\n\nSetiapPembelianCITYHATCHBACKdapatkan\n-KacaFilmWincos\n-Warrantyselama3tahun\u002F100rb\n-Tatakanplat\n-Payung\n-KarpetOri\n-P3K\n-DudukanPlat\n-Talangair\n-APAR\n\nTersedia6varianwarna\n-PhoenixOrangePearlc\n-PlatinumWhitePearl\n-LunarSilverMetallic\n-RallyeRed\n-MeteoridGreyMetallic\n-CrystalBlackPearl\n\n*BisaTukarTambahdenganmobilbekas\n*Tersediapaket2kreditHondaTipelainnya","created_at":"2022-06-07T11:14:42+07:00","inspection_info":null,"title":"[MobilBaru]PromoKreditHONDACITYHATCHBACK2022TERBARU","partner_id":null,"user_type":"Regular","price":{"value":{"raw":0,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp322.100.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"37","external_id":"pfrlb8kopj09-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fpfrlb8kopj09-ID\u002Fime"},{"id":"38","external_id":"5hdmybaukt7i2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5hdmybaukt7i2-ID\u002Fime"},{"id":"39","external_id":"pfhh76w30utb-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fpfhh76w30utb-ID\u002Fime"},{"id":"40","external_id":"idhmx7nbz3ym1-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fidhmx7nbz3ym1-ID\u002Fime"}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":true,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JawaBarat","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"BandungKota","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Buahbatu(Margacinta)"},"deal_price":null,"business_platform":null,"main_info":"2022","display_date":"2022-06-07T03:16:31+0000","user_id":"0","installment":null,"created_at_first":"2022-06-07T10:16:31+07:00","locations":[{"lat":-6.955,"lon":107.647,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"make","value_name":"Honda","value":"mobil-bekas-honda","key_name":"Merek","formatted_value":"Honda"},{"type":"single","key":"m_tipe","value_name":"City","value":"mobil-bekas-honda-city","key_name":"Model","formatted_value":"City"},{"type":"single","key":"m_year","value_name":"2022","value":"2022","key_name":"Tahun","formatted_value":"2022"},{"type":"single","key":"milee","value_name":"0-5.000","value":"5","key_name":"Jaraktempuh","formatted_value":"0-5.000km"},{"type":"single","key":"m_fuel","value_name":"Bensin","value":"bensin","key_name":"Tipebahanbakar","formatted_value":"Bensin"},{"type":"single","key":"m_color","value_name":"Hitam","value":"hitam","key_name":"Warna","formatted_value":"Hitam"},{"type":"single","key":"m_transmission","value_name":"Automatic","value":"automatic","key_name":"Transmisi","formatted_value":"Automatic"}]},"5":{"id":"5","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"198","forites":{"count":8,"count_label":"8","count_label_next":"9","count_label_prev":"7"},"vasTs":["verified_seller"],"has_phone_param":false,"description":"DIJUAL\n\nHONDACIVIC1.5ESTURBOSEDAN2016MATIC\n\nSurat2LengkapFakturAda\nAsliPlatH\nTanganPertama\nAnPerorangan\nPajekBln82022\nKunciSerepLengkap\nBukuServisDanPanduanAda\nKm90rbAsli\nServisRecordDiler\nMaticRenposif\nKaki2SuperSenyap\nInteriorFulOriginal\nBanTebelTebel\nCetOrisinilan\nJaminanTidakBekasLaka\u002FBanjir\n\nCarsentroLotteMart\nFMAutoCars\nSemarang","created_at":"2022-06-22T18:44:54+07:00","inspection_info":{"inspection_id":"a2ce5366-f7b4-45f6-9d4f-d2f2a1f5ba9b","group":"CONSUMER"},"title":"HONDACIVIC1.5ESTURBOSEDAN2016MATIC","car_body_type":"sedan","partner_id":null,"user_type":"Regular","price":{"value":{"raw":0,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp347.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"01","external_id":"ibmetotrwesv1-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fibmetotrwesv1-ID\u002Fime"},{"id":"91","external_id":"mc9tn5h0j8tg-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmc9tn5h0j8tg-ID\u002Fime"},{"id":"02","external_id":"qvnl294l2lvj2-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqvnl294l2lvj2-ID\u002Fime"},{"id":"04","external_id":"5u3m6ghazhb5-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5u3m6ghazhb5-ID\u002Fime"},{"id":"05","external_id":"lh2kgt9w6f1g3-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Flh2kgt9w6f1g3-ID\u002Fime"},{"id":"06","external_id":"xnfvhu3sk29e2-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fxnfvhu3sk29e2-ID\u002Fime"},{"id":"03","external_id":"7hkg05wo8poa1-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7hkg05wo8poa1-ID\u002Fime"},{"id":"94","external_id":"9lq011s3q041-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F9lq011s3q041-ID\u002Fime"},{"id":"88","external_id":"5iv5egvlwi8x-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5iv5egvlwi8x-ID\u002Fime"},{"id":"87","external_id":"qpbroyji0ijd-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqpbroyji0ijd-ID\u002Fime"},{"id":"95","external_id":"esjji7aytcsh1-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fesjji7aytcsh1-ID\u002Fime"},{"id":"96","external_id":"fjyojr6akdjn-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ffjyojr6akdjn-ID\u002Fime"},{"id":"97","external_id":"wibfgwc1-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fwibfgwc1-ID\u002Fime"},{"id":"98","external_id":"jutkt2i8dqt63-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjutkt2i8dqt63-ID\u002Fime"},{"id":"99","external_id":"obbr3hutbs6v3-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fobbr3hutbs6v3-ID\u002Fime"},{"id":"92","external_id":"yal5p4dsuwt23-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fyal5p4dsuwt23-ID\u002Fime"},{"id":"00","external_id":"p53yxa3e7z5s1-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fp53yxa3e7z5s1-ID\u002Fime"},{"id":"89","external_id":"5bd18zhe9h8d3-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5bd18zhe9h8d3-ID\u002Fime"},{"id":"93","external_id":"alc7997z83t11-ID","width":1600,"height":1200,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Falc7997z83t11-ID\u002Fime"},{"id":"90","external_id":"d6ok7ryd8vun3-ID","width":1200,"height":1600,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fd6ok7ryd8vun3-ID\u002Fime"}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":true,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JawaTengah","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"SemarangKota","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SemarangTimur"},"deal_price":null,"business_platform":null,"main_info":"2016","display_date":"2022-06-14T16:10:06+0000","user_id":"","installment":null,"created_at_first":"2022-06-14T23:10:06+07:00","locations":[{"lat":-6.972,"lon":110.435,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"make","value_name":"Honda","value":"mobil-bekas-honda","key_name":"Merek","formatted_value":"Honda"},{"type":"single","key":"m_tipe","value_name":"Civic","value":"mobil-bekas-honda-civic","key_name":"Model","formatted_value":"Civic"},{"type":"single","key":"m_tipe_variant","value_name":"1.5ESBensin","value":"civic-1.5-es-bensin","key_name":"Varian","formatted_value":"1.5ESBensin"},{"type":"single","key":"m_year","value_name":"2016","value":"2016","key_name":"Tahun","formatted_value":"2016"},{"type":"single","key":"milee","value_name":"85.000-90.000","value":"90","key_name":"Jaraktempuh","formatted_value":"85.000-90.000km"},{"type":"single","key":"m_fuel","value_name":"Bensin","value":"bensin","key_name":"Tipebahanbakar","formatted_value":"Bensin"},{"type":"single","key":"m_color","value_name":"Hitam","value":"hitam","key_name":"Warna","formatted_value":"Hitam"},{"type":"single","key":"m_transmission","value_name":"Automatic","value":"automatic","key_name":"Transmisi","formatted_value":"Automatic"},{"type":"single","key":"m_body","value_name":"Sedan","value":"sedan","key_name":"Tipebodi","formatted_value":"Sedan"},{"type":"single","key":"m_engine_capacity","value_name":"\u003E1.000-1.500cc","value":"1000-to-1500","key_name":"Kapasitasmesin","formatted_value":"\u003E1.000-1.500cc"},{"type":"single","key":"m_seller_type","value_name":"Diler","value":"seller-type-diler","key_name":"TipePenjual","formatted_value":"Diler"},{"type":"single","key":"m_exchange","value_name":"CarsentroSemarang","value":"carsentro-semarang","key_name":"NamaBursaMobil","formatted_value":"CarsentroSemarang"}]},"3":{"id":"3","score":1,"spell":{"id":2,"key":"DETECT_POISON","version":"1","main":false,"facet_disabled":true,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"213","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"Laptop2in1MerkHPPilion11-ab128TUConvertibleX360CeleronN4000Ram4GBHDD\nKelengkapansemuaadaoriginaldaripabrik\nLecetpemakaian,tidakadakerusakan","created_at":"2022-06-16T06:59:36+07:00","inspection_info":null,"title":"Laptop2in1MerkHPPilion11-ab128TU","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp3.500.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"49","external_id":"c0to8thb9sp2-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fc0to8thb9sp2-ID\u002Fime"},{"id":"50","external_id":"h9vtem8j1rx82-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fh9vtem8j1rx82-ID\u002Fime"},{"id":"51","external_id":"8ncb56u1ije11-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F8ncb56u1ije11-ID\u002Fime"},{"id":"52","external_id":"6qt5huym2qow2-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F6qt5huym2qow2-ID\u002Fime"},{"id":"53","external_id":"ayvaz8pbajpu3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fayvaz8pbajpu3-ID\u002Fime"}],"certified_car":false,"packe":{"id":""},"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"KalimantanSelatan","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"BanjarmasinKota","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"BanjarmasinTimur"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-15T23:59:36+0000","user_id":"4","installment":null,"created_at_first":"2022-06-16T06:59:36+07:00","locations":[{"lat":-3.325,"lon":114.625,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Laptop","value":"elektronik-gadget-komputer-laptop","key_name":"Tipe","formatted_value":"Laptop"},{"type":"single","key":"condition","value_name":"Bekas","value":"bekas","key_name":"Kondisi","formatted_value":"Bekas"}]},"8":{"id":"8","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"MENERIMABERBAIPESANANCUSTOMINTERIOR:\n\nGorden-wallpaper-rollerblind-verticalblind-horizontalblind\u002Fkrey-danlainlain.\n\nBerikutkamiberikankisaranrincianhargauntukgordyn:\nHargamulaidari\nRp.60.000\u002Fm²s\u002FdRp.100.000\u002Fm²(untukbahanlokal)\nRp.100.000\u002Fm²s\u002FdRp.300.000\u002Fm²(untukbahanimport)\nRp.350.000\u002Fm²s\u002FdRp.800.000\u002Fm²(untukgordrnmodelBlinds)\n\nSedangkanuntukwallpaper:\nWallpapercustomDesign270.000\u002Fm²\nWallpaperKoreaCatalog90.000\u002Fm²s\u002Fd180.000\u002Fm²\n\n•PASTIKANANDAMENDAPATKANLAYANANTERBAIKDARIAHLINYA!!\n\n•Profesional&berpengalaman\n\n•Rapih&Detil\n\n•Hargakompetitif\n\n•TepatWaktu\n\n•Menjaminkepuasankonsumen\n\n*Jangansungkanmengajukanrequestprodukdengansenanghatikamiakanmembantu...terimakasihsalamhangatsalamsukses.\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\n(Lx3)x(T+30cm)\nKet:\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntukatas15cmdanlipatanbawah15cm\nExample: \nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterpersegi\nJaditotalpemakayanbahanuntukjendelaukuran1mx2madalah6,9meterpersegi(m2).","created_at":"2022-06-27T06:59:05+07:00","inspection_info":null,"packe_id":null,"title":"GordenMinimalisGordynKordenHordengBlindsCurtainWallaperDinding","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp50.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"01","external_id":"mq4e52d41d5n3-ID","width":705,"height":705,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmq4e52d41d5n3-ID\u002Fime"},{"id":"02","external_id":"dij3y8vrb88b2-ID","width":1080,"height":1079,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fdij3y8vrb88b2-ID\u002Fime"},{"id":"03","external_id":"hcrzpz32-ID","width":800,"height":800,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fhcrzpz32-ID\u002Fime"},{"id":"04","external_id":"20gd1859m2fs1-ID","width":712,"height":712,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F20gd1859m2fs1-ID\u002Fime"},{"id":"05","external_id":"mj46ksaltwix2-ID","width":719,"height":719,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmj46ksaltwix2-ID\u002Fime"},{"id":"06","external_id":"jojfhfhrkp2-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fjojfhfhrkp2-ID\u002Fime"},{"id":"07","external_id":"yriah96hngm73-ID","width":720,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fyriah96hngm73-ID\u002Fime"},{"id":"08","external_id":"c3e2s2om29hd1-ID","width":1080,"height":1079,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fc3e2s2om29hd1-ID\u002Fime"},{"id":"09","external_id":"1zqpbjux61ze2-ID","width":691,"height":691,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1zqpbjux61ze2-ID\u002Fime"},{"id":"10","external_id":"loh92skc5cvi2-ID","width":509,"height":509,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Floh92skc5cvi2-ID\u002Fime"},{"id":"11","external_id":"1t3i43mr80qk1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1t3i43mr80qk1-ID\u002Fime"},{"id":"12","external_id":"ibf3mvhxx20n-ID","width":1037,"height":1037,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fibf3mvhxx20n-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Jatinegara"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:59:05+0000","user_id":"5","installment":null,"created_at_first":"2022-06-19T00:38:20+07:00","locations":[{"lat":-6.23,"lon":106.882,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"9":{"id":"9","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"MENERIMABERBAIPESANANCUSTOMINTERIOR:\n\nGorden-wallpaper-rollerblind-verticalblind-horizontalblind\u002Fkrey-danlainlain.\n\nBerikutkamiberikankisaranrincianhargauntukgordyn:\nHargamulaidari\nRp.60.000\u002Fm²s\u002FdRp.100.000\u002Fm²(untukbahanlokal)\nRp.100.000\u002Fm²s\u002FdRp.300.000\u002Fm²(untukbahanimport)\nRp.350.000\u002Fm²s\u002FdRp.800.000\u002Fm²(untukgordrnmodelBlinds)\n\nSedangkanuntukwallpaper:\nWallpapercustomDesign270.000\u002Fm²\nWallpaperKoreaCatalog90.000\u002Fm²s\u002Fd180.000\u002Fm²\n\n•PASTIKANANDAMENDAPATKANLAYANANTERBAIKDARIAHLINYA!!\n\n•Profesional&berpengalaman\n\n•Rapih&Detil\n\n•Hargakompetitif\n\n•TepatWaktu\n\n•Menjaminkepuasankonsumen\n\n*Jangansungkanmengajukanrequestprodukdengansenanghatikamiakanmembantu...terimakasihsalamhangatsalamsukses.\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\n(Lx3)x(T+30cm)\nKet:\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntukatas15cmdanlipatanbawah15cm\nExample: \nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterpersegi\nJaditotalpemakayanbahanuntukjendelaukuran1mx2madalah6,9meterpersegi(m2).","created_at":"2022-06-27T06:58:18+07:00","inspection_info":null,"packe_id":null,"title":"GordenMinimalisGordynKordenHordengBlindsCurtainWallaperDinding","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp50.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"72","external_id":"0ul35btey8ju-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F0ul35btey8ju-ID\u002Fime"},{"id":"73","external_id":"v8a3fxoxlzw73-ID","width":960,"height":960,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fv8a3fxoxlzw73-ID\u002Fime"},{"id":"74","external_id":"2l8aivcx168z-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F2l8aivcx168z-ID\u002Fime"},{"id":"75","external_id":"c88qaqkw7omb1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fc88qaqkw7omb1-ID\u002Fime"},{"id":"76","external_id":"1u7fdmihlb1-ID","width":720,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1u7fdmihlb1-ID\u002Fime"},{"id":"77","external_id":"7gemnu0lql0h-ID","width":960,"height":960,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7gemnu0lql0h-ID\u002Fime"},{"id":"78","external_id":"166hpam0caiq3-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F166hpam0caiq3-ID\u002Fime"},{"id":"79","external_id":"q67he7pva4ch1-ID","width":749,"height":520,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fq67he7pva4ch1-ID\u002Fime"},{"id":"80","external_id":"ku0ssr1s1awu1-ID","width":453,"height":453,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fku0ssr1s1awu1-ID\u002Fime"},{"id":"81","external_id":"36v8kz3rptn52-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F36v8kz3rptn52-ID\u002Fime"},{"id":"82","external_id":"q0p2tnvqbuuy-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fq0p2tnvqbuuy-ID\u002Fime"},{"id":"83","external_id":"7dskpr3h1icn1-ID","width":720,"height":720,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7dskpr3h1icn1-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Matraman"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:58:18+0000","user_id":"5","installment":null,"created_at_first":"2022-06-19T00:38:34+07:00","locations":[{"lat":-6.203,"lon":106.862,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"1":{"id":"1","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"OFFICIALGORDYN\n\nSistemOrder:\nGratisSurveryLokasi\nKonsultasi\nDesign&Modeling\nPengukuran\nPemilihanBahan&Motif\nProduksi&Instalas\n\nBertemuLangsungSamaPenjualAdalahCaraTeramanBertransaksi&LebihDetail.\nSemuapesananakandiprosessesuaidengankesepakatanawal\u002Fbersama.\n\nHargagordenyangterteraperlembarbahanbukanperlembargordenjadi.\n\nHargaGorden\nRp.60.000s\u002FdRp.100.000(UntukBahanLokal)\nRp.120.000s\u002FdRp.300.000(UntukBahanImport)\n\nHargaWallpaper\nRp.90.000\u002Fm²-160.000\u002Fm²(WallpaperKorea\u002FPremium)\nRp.170.000\u002Fm²-350.000\u002Fm²(WallpaperCustom3D)\n\nHargajenisblind\u002Fkerai:\nRp.280.000\u002Fm²-365.000\u002Fm²(Pertikalblind)\nRp.300.000\u002Fm²-475.000\u002Fm²(Rollerblind)\nRp.325.000\u002Fm²-450.000\u002Fm²(Wodenblind\u002Fkerai)\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\nKet:(Lx3)x(T+30cm).\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntuklipatanatas15cmdanlipatanbawah15cm\nExample:\nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterstaffsurveyorygprofesionaluntukmengunjungirumahanda,denganmembawasamplebahansekaligusmelakukanpengukuranditempatanda.\n\nGRATISbiayasurvey,pengukurandanpemasangan(Sejabodetabek).\n(BiYgBerminatSeriusBisaLangsungTlpn\u002FWhatsap).","created_at":"2022-06-27T06:57:33+07:00","inspection_info":null,"packe_id":null,"title":"SEPESIALISGORDENCUSTUMBAHANINFORTDANLOKAL#40","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp60.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"61","external_id":"04zjv38y269s1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F04zjv38y269s1-ID\u002Fime"},{"id":"62","external_id":"tad19an6m4yd3-ID","width":863,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ftad19an6m4yd3-ID\u002Fime"},{"id":"63","external_id":"n4ow6y1bfxyt-ID","width":864,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fn4ow6y1bfxyt-ID\u002Fime"},{"id":"64","external_id":"kf7amjiihpow1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fkf7amjiihpow1-ID\u002Fime"},{"id":"65","external_id":"1s5es28j7kuu1-ID","width":1046,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F1s5es28j7kuu1-ID\u002Fime"},{"id":"66","external_id":"pgef00rrrmw23-ID","width":1073,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fpgef00rrrmw23-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Jatinegara"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:57:33+0000","user_id":"8","installment":null,"created_at_first":"2022-06-19T19:35:41+07:00","locations":[{"lat":-6.23,"lon":106.882,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"4":{"id":"4","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"OFFICIALGORDYN\n\nSistemOrder:\nGratisSurveryLokasi\nKonsultasi\nDesign&Modeling\nPengukuran\nPemilihanBahan&Motif\nProduksi&Instalas\n\nBertemuLangsungSamaPenjualAdalahCaraTeramanBertransaksi&LebihDetail.\nSemuapesananakandiprosessesuaidengankesepakatanawal\u002Fbersama.\n\nHargagordenyangterteraperlembarbahanbukanperlembargordenjadi.\n\nHargaGorden\nRp.60.000s\u002FdRp.100.000(UntukBahanLokal)\nRp.120.000s\u002FdRp.300.000(UntukBahanImport)\n\nHargaWallpaper\nRp.90.000\u002Fm²-160.000\u002Fm²(WallpaperKorea\u002FPremium)\nRp.170.000\u002Fm²-350.000\u002Fm²(WallpaperCustom3D)\n\nHargajenisblind\u002Fkerai:\nRp.280.000\u002Fm²-365.000\u002Fm²(Pertikalblind)\nRp.300.000\u002Fm²-475.000\u002Fm²(Rollerblind)\nRp.325.000\u002Fm²-450.000\u002Fm²(Wodenblind\u002Fkerai)\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\nKet:(Lx3)x(T+30cm).\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntuklipatanatas15cmdanlipatanbawah15cm\nExample:\nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterstaffsurveyorygprofesionaluntukmengunjungirumahanda,denganmembawasamplebahansekaligusmelakukanpengukuranditempatanda.\n\nGRATISbiayasurvey,pengukurandanpemasangan(Sejabodetabek).\n(BiYgBerminatSeriusBisaLangsungTlpn\u002FWhatsap).","created_at":"2022-06-27T06:57:20+07:00","inspection_info":null,"packe_id":null,"title":"CUSTUMGORDENTERBAIKBAHANINFORT\u002FLOKAL#42","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp385.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"05","external_id":"5ircwc2jjj6i2-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5ircwc2jjj6i2-ID\u002Fime"},{"id":"06","external_id":"alxjdww4gfxm-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Falxjdww4gfxm-ID\u002Fime"},{"id":"07","external_id":"d5ubtr990t6o3-ID","width":1080,"height":718,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fd5ubtr990t6o3-ID\u002Fime"},{"id":"08","external_id":"3395gu4rhudz2-ID","width":1080,"height":974,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F3395gu4rhudz2-ID\u002Fime"},{"id":"09","external_id":"bt68grw31ac82-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbt68grw31ac82-ID\u002Fime"},{"id":"10","external_id":"0u08sbmp1zp23-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F0u08sbmp1zp23-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Jatinegara"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:57:20+0000","user_id":"8","installment":null,"created_at_first":"2022-06-19T19:36:10+07:00","locations":[{"lat":-6.23,"lon":106.882,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"7":{"id":"7","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4836","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"OFFICIALGORDYN\n\nSistemOrder:\nGratisSurveryLokasi\nKonsultasi\nDesign&Modeling\nPengukuran\nPemilihanBahan&Motif\nProduksi&Instalas\n\nBertemuLangsungSamaPenjualAdalahCaraTeramanBertransaksi&LebihDetail.\nSemuapesananakandiprosessesuaidengankesepakatanawal\u002Fbersama.\n\nHargagordenyangterteraperlembarbahanbukanperlembargordenjadi.\n\nHargaGorden\nRp.60.000s\u002FdRp.100.000(UntukBahanLokal)\nRp.120.000s\u002FdRp.300.000(UntukBahanImport)\n\nHargaWallpaper\nRp.90.000\u002Fm²-160.000\u002Fm²(WallpaperKorea\u002FPremium)\nRp.170.000\u002Fm²-350.000\u002Fm²(WallpaperCustom3D)\n\nHargajenisblind\u002Fkerai:\nRp.280.000\u002Fm²-365.000\u002Fm²(Pertikalblind)\nRp.300.000\u002Fm²-475.000\u002Fm²(Rollerblind)\nRp.325.000\u002Fm²-450.000\u002Fm²(Wodenblind\u002Fkerai)\n\nRumusCaraMenghitungPemakaianBahan(meterPersegi):\nKet:(Lx3)x(T+30cm).\n(Lx3)fungsinyauntukpembentukangelombang\u002Fpluyi,karnagordynitubergelombangtidakmembentangsepertilayaryangmembentang.\n(T+30cm)30cmFungsinyauntuklipatanatas15cmdanlipatanbawah15cm\nExample:\nJendelaukuranL=1m,T=2m\n=(Lx3)x(T+30cm)\n=(100x3)x(200+30)\n=300x230\n=6,9meterstaffsurveyorygprofesionaluntukmengunjungirumahanda,denganmembawasamplebahansekaligusmelakukanpengukuranditempatanda.\n\nGRATISbiayasurvey,pengukurandanpemasangan(Sejabodetabek).\n(BiYgBerminatSeriusBisaLangsungTlpn\u002FWhatsap).","created_at":"2022-06-27T06:55:34+07:00","inspection_info":null,"packe_id":null,"title":"SEPESIALISGORDENCUSTUMBAHANINFORTDANLOKAL#50","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp385.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"55","external_id":"5xsbz41pslti3-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F5xsbz41pslti3-ID\u002Fime"},{"id":"56","external_id":"s52fl39y6hs12-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fs52fl39y6hs12-ID\u002Fime"},{"id":"57","external_id":"39c9dhn5ix3z-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F39c9dhn5ix3z-ID\u002Fime"},{"id":"58","external_id":"zl16w5bmfbzy2-ID","width":1080,"height":656,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fzl16w5bmfbzy2-ID\u002Fime"},{"id":"59","external_id":"bc7fq80q5d85-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbc7fq80q5d85-ID\u002Fime"},{"id":"60","external_id":"edw1woo5w84n3-ID","width":1080,"height":808,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fedw1woo5w84n3-ID\u002Fime"},{"id":"61","external_id":"e5pstkswuhu03-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fe5pstkswuhu03-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaTimur","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"Matraman"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:55:34+0000","user_id":"8","installment":null,"created_at_first":"2022-06-19T19:40:13+07:00","locations":[{"lat":-6.203,"lon":106.862,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"condition","value_name":"Baru","value":"baru","key_name":"Kondisi","formatted_value":"Baru"}]},"5":{"id":"5","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"4827","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"DijualRumahTuaHitungTanahdiMampangPrapatanJakartaSelatan.\n\nBebasBanjir&jalan2mobil.\n\nSuratsuratSHM&HGB\nHarga15.500.000\u002Fmeter\n\nNJOPdiPBB18.600.000\u002Fmeter\n\nLokasiSangatStrategis:\n\n-dekatkejalan2protokol\n-mampangprapatan\n-gatotsubroto\n-sekolah&supermaket","created_at":"2022-06-27T06:55:46+07:00","inspection_info":null,"packe_id":null,"title":"TanahMurahdijualdiMampangPrapatanJakartaSelatan","partner_id":null,"user_type":"Regular","price":{"value":{"raw":,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp15.500.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"88","external_id":"7rh8ybflk5db-ID","width":1080,"height":986,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F7rh8ybflk5db-ID\u002Fime"},{"id":"89","external_id":"temhkdgp7jrr3-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Ftemhkdgp7jrr3-ID\u002Fime"},{"id":"90","external_id":"mvc6c3zcbu0k3-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fmvc6c3zcbu0k3-ID\u002Fime"},{"id":"91","external_id":"x04kikm04fbc-ID","width":810,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fx04kikm04fbc-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"MampangPrapatan"},"deal_price":null,"business_platform":null,"main_info":null,"display_date":"2022-06-26T23:55:45+0000","user_id":"","installment":null,"created_at_first":"2022-06-27T06:55:45+07:00","locations":[{"lat":-6.25,"lon":106.82,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Dijual","value":"dijual","key_name":"Tipe","formatted_value":"Dijual"},{"type":"single","key":"p_sqr_land","value_name":"1295","value":"1295","key_name":"Luastanah","formatted_value":"1295"},{"type":"single","key":"p_certificate","value_name":"SHM-SertifikatHakMilik","value":"shm-sertifikathakmilik","key_name":"Sertifikasi","formatted_value":"SHM-SertifikatHakMilik"}]},"1":{"id":"1","score":1,"spell":{"id":41,"key":"TIMESTOP","version":"7","main":true,"facet_disabled":false,"default_sorting":"DEFAULT"},"status":{"status":"active","allow_edit":true,"ban_reason_id":null,"display":"active","translated_display":"Aktif","link":null,"fls":{"new":false,"hot":false},"messe":null,"allow_deactivate":true},"category_id":"5158","forites":{"count":0,"count_label_next":"1"},"has_phone_param":false,"description":"NewBrandEropaModernKontemporer.\n\nRumahMewah2LTdiSELATANJAKARTA\nLingkunganSangatNyaman,aksesstrategisdekatpintutol,terintregitasdengantolpusatkota,dekatkeBandaraPondokCabe.\n\nCapitalgainssangatbusprospeknya,LokasitepatdipusatpemerintahanKota.Hanya2menitdariKantorWalikota.\n\nKamimenawarkanKonsepyangMewahdiluasantanah100m2(8x12,5)danpastinyadenganyanghargaSUPERMURAH.\n\nBerikutpilihanTypeunitnyaBesertaharganya:\n-LT100m2\u002FLB90m2\nHargaKPR1,3M\nHargaCash\u002FBertahap1,2M\n\n-LT100m2\u002FLB75m2\nHargaKPR1,250M\nHargaCash\u002FBertahap1,1M\n\nMAUhargalebihhematBUDGET999juta?BISA!Konsultasikansegerapadakami.\n\nDapatkanextrabonusdenganbookingonthespot.\n\nSMARTCHOICEFORBETTERLIFE,Terimakasih.\n\nSalamhangat,\nTiara","created_at":"2022-06-27T06:56:27+07:00","inspection_info":null,"packe_id":null,"title":"RumahMewahBergayaEropaTerbaruSelangkahkeTolSerpongSHM","partner_id":null,"user_type":"Regular","price":{"value":{"raw":0,"currency":{"iso_4217":"IDR","pre":"Rp"},"display":"Rp999.000.000"},"key_name":"Harga","key":"price"},"partner_code":null,"monetizationInfo":null,"imes":[{"id":"97","external_id":"i25mg99t569x-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fi25mg99t569x-ID\u002Fime"},{"id":"98","external_id":"846ntl3vk64i-ID","width":945,"height":1280,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F846ntl3vk64i-ID\u002Fime"},{"id":"99","external_id":"imhx9xnzmg4o3-ID","width":672,"height":496,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fimhx9xnzmg4o3-ID\u002Fime"},{"id":"00","external_id":"u63chzqq6j2v1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fu63chzqq6j2v1-ID\u002Fime"},{"id":"01","external_id":"59wz3k1qx3o61-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F59wz3k1qx3o61-ID\u002Fime"},{"id":"02","external_id":"l0afa9ra8qci1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fl0afa9ra8qci1-ID\u002Fime"},{"id":"03","external_id":"d0xgqf72es791-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fd0xgqf72es791-ID\u002Fime"},{"id":"04","external_id":"107uqtd3nezl-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F107uqtd3nezl-ID\u002Fime"},{"id":"05","external_id":"ppekpm5prr1k2-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fppekpm5prr1k2-ID\u002Fime"},{"id":"06","external_id":"m1wujruof5a01-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fm1wujruof5a01-ID\u002Fime"},{"id":"07","external_id":"rru70r8nbps03-ID","width":1080,"height":810,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Frru70r8nbps03-ID\u002Fime"},{"id":"08","external_id":"0cg60o16bgrt2-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F0cg60o16bgrt2-ID\u002Fime"},{"id":"09","external_id":"odrsdqgotkl8-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fodrsdqgotkl8-ID\u002Fime"},{"id":"10","external_id":"qmvah6tknf541-ID","width":1080,"height":1044,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fqmvah6tknf541-ID\u002Fime"},{"id":"11","external_id":"hi3mti4m5azl3-ID","width":399,"height":254,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fhi3mti4m5azl3-ID\u002Fime"},{"id":"12","external_id":"2x65ttttz7vi1-ID","width":1080,"height":1080,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002F2x65ttttz7vi1-ID\u002Fime"},{"id":"13","external_id":"bl0halndwic42-ID","width":686,"height":496,"url":":\u002F\u002Fapollo-singapore.akamaized.net:443\u002Fv1\u002Ffiles\u002Fbl0halndwic42-ID\u002Fime"}],"certified_car":false,"is_kyc_verified_user":false,"locations_resolved":{"COUNTRY_id":"","COUNTRY_name":"Indonesia","ADMIN_LEVEL_1_id":"","ADMIN_LEVEL_1_name":"JakartaD.K.I.","ADMIN_LEVEL_3_id":"","ADMIN_LEVEL_3_name":"JakartaSelatan","SUBLOCALITY_LEVEL_1_id":"","SUBLOCALITY_LEVEL_1_name":"SetiaBudi"},"deal_price":null,"business_platform":null,"main_info":"3KT-2KM-65m2","display_date":"2022-06-26T23:56:24+0000","user_id":"2","installment":null,"created_at_first":"2022-06-27T06:56:24+07:00","locations":[{"lat":-6.219,"lon":106.832,"region_id":"","district_id":"","city_id":""}],"parameters":[{"type":"single","key":"type","value_name":"Rumah","value":"rumah","key_name":"Tipe","formatted_value":"Rumah"},{"type":"single","key":"p_sqr_building","value_name":"65","value":"65","key_name":"Luasbangunan","formatted_value":"65"},{"type":"single","key":"p_sqr_land","value_name":"100","value":"100","key_name":"Luastanah","formatted_value":"100"},{"type":"single","key":"p_bedroom","value_name":"3","value":"3","key_name":"Kamartidur","formatted_value":"3"},{"type":"single","key":"p_bathroom","value_name":"2","value":"2","key_name":"KamarMandi","formatted_value":"2"},{"type":"single","key":"p_floor","value_name":"2","value":"2","key_name":"Lantai","formatted_value":"2"},{"type":"multi","key":"p_facility","values":[{"value":"ac"},{"value":"swimmingpool"},{"value":"carport"},{"value":"garden"}],"key_name":"Fasilitas"},{"type":"single","key":"p_certificate","value_name":"SHM-SertifikatHakMilik","value":"shm-sertifikathakmilik","key_name":"Sertifikasi","formatted_value":"SHM-SertifikatHakMilik"},{"type":"single","key":"p_alamat","value_name":"JL.BENDAPAMULANGDEKATKANTORWALIKOTATANGERANGSELATAN","value":"JL.BENDAPAMULANGDEKATKANTORWALIKOTATANGERANGSELATAN","key_name":"Alamatlokasi","formatted_value":"JL.BENDAPAMULANGDEKATKANTORWALIKOTATANGERANGSELATAN"}]}},"errorsMetadata":{},"metadataKey":"ads","lastCollectionUrl":"\u002Fapi\u002Frelevance\u002Ffeed?latitude=-6.&location=&longitude=106.","collectionList":["\u002Fapi\u002Frelevance\u002Ffeed?latitude=-6.&location=&longitude=106."],"aditionalMetadataKeys":["filters","links","appliedFilters","applied_sorting","sortingOptions","feed_version","applied_filters","modified_filters","modified_term","sections","suggested_sections","suggestions_offset","original_term","suggested_term","original_label","suggested_label","show_suggested_items","show_original_items","total_pes","show_hint","hint","total_suggested_ads","total_suggested_pes","suggested_ads_on_pe","resultset_id","unfiltered_total","showDownloadLeads"]},"users":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"users"},"categories":{"collections":{"categories#\u002Fapi\u002Fcategories":["86","88","87","97","92","94","89","98","96","90"]},"isFetching":{"categories#\u002Fapi\u002Fcategories":false},"isError":{"categories#\u002Fapi\u002Fcategories":false},"collectionMetadata":{"categories#\u002Fapi\u002Fcategories":{}},"elements":{"86":{"id":"86","key":"mobil","display_order":100,"name":"Mobil","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-86","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["198","4760","4762","4759","4761","4662"],"slug":"mobil\u002F","parent_id":0},"87":{"id":"87","key":"motor","display_order":300,"name":"Motor","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-87","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-price","desc-price","asc-distance"],"default":"desc-relevance"},"sub_categories":["200","4823","4824","4822"],"slug":"motor\u002F","parent_id":0},"88":{"id":"88","key":"properti","display_order":200,"name":"Properti","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-88","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["5158","5160","4827","4833","5154","5156"],"slug":"properti\u002F","parent_id":0},"89":{"id":"89","key":"rumah-tangga","display_order":700,"name":"RumahTangga","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-89","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["4845","4835","4836","4842","4841","4844","202","4843"],"slug":"rumah-tangga\u002F","parent_id":0},"90":{"id":"90","key":"kantor-industri","display_order":1000,"name":"Kantor&Industri","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-90","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["203","5090","4846","4852","4853"],"slug":"kantor-industri\u002F","parent_id":0},"92":{"id":"92","key":"elektronik-gadget","display_order":500,"name":"Elektronik&Gadget","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-92","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["208","209","215","211","214","212","213","4952","210"],"slug":"elektronik-gadget\u002F","parent_id":0},"94":{"id":"94","key":"hobi-olahra","display_order":600,"name":"Hobi&Olahra","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-94","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["217","218","219","222","4964","220","221","223","4975","235"],"slug":"hobi-olahra\u002F","parent_id":0},"96":{"id":"96","key":"perlengkapan-bayi-anak","display_order":900,"name":"PerlengkapanBayi&Anak","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-96","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["5049","224","5048","5142","5046","5053","5047"],"slug":"perlengkapan-bayi-anak\u002F","parent_id":0},"97":{"id":"97","key":"jasa-lowongan-kerja","display_order":400,"name":"Jasa&LowonganKerja","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-97","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["226","227","228"],"slug":"jasa-lowongan-kerja\u002F","parent_id":0},"98":{"id":"98","key":"keperluan-pribadi","display_order":800,"name":"KeperluanPribadi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-98","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"sub_categories":["230","229","231","5095","232","233","5123","234","5126","5124"],"slug":"keperluan-pribadi\u002F","parent_id":0},"198":{"id":"198","key":"mobil-bekas","display_order":0,"name":"MobilBekas","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"{m_year}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"mobil-bekas\u002F","parent_id":"86"},"200":{"id":"200","key":"motor-bekas","display_order":0,"name":"MotorBekas","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"{m_year}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"motor-bekas\u002F","parent_id":"87"},"202":{"id":"202","key":"rumah-tangga-perlengkapan-rumah","display_order":6,"name":"PerlengkapanRumah","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-202","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perlengkapan-rumah\u002F","parent_id":"89"},"203":{"id":"203","key":"kantor-industri-peralatan-kantor","display_order":1,"name":"PeralatanKantor","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-203","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"peralatan-kantor\u002F","parent_id":"90"},"208":{"id":"208","key":"elektronik-gadget-handphone","display_order":0,"name":"Handphone","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-208","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"handphone\u002F","parent_id":"92"},"209":{"id":"209","key":"elektronik-gadget-tablet","display_order":1,"name":"Tablet","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-209","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"tablet\u002F","parent_id":"92"},"210":{"id":"210","key":"elektronik-gadget-tv-audio-video","display_order":8,"name":"TV&Audio,Video","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-210","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"tv-audio-video\u002F","parent_id":"92"},"211":{"id":"211","key":"elektronik-gadget-fotografi","display_order":3,"name":"Fotografi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-211","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"fotografi\u002F","parent_id":"92"},"212":{"id":"212","key":"elektronik-gadget-games-console","display_order":5,"name":"Games&Console","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-212","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"games-console\u002F","parent_id":"92"},"213":{"id":"213","key":"elektronik-gadget-komputer","display_order":6,"name":"Komputer","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-213","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"komputer\u002F","parent_id":"92"},"214":{"id":"214","key":"elektronik-gadget-elektronik-rumah-tangga","display_order":4,"name":"ElektronikRumahTangga","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-214","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"elektronik-rumah-tangga\u002F","parent_id":"92"},"215":{"id":"215","key":"elektronik-gadget-aksesoris-hp-tablet","display_order":2,"name":"AksesorisHP&Tablet","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-215","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"aksesoris-hp-tablet\u002F","parent_id":"92"},"217":{"id":"217","key":"hobi-olahra-alat-alat-musik","display_order":0,"name":"Alat-alatMusik","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-217","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"alat-alat-musik\u002F","parent_id":"94"},"218":{"id":"218","key":"hobi-olahra-olahra","display_order":1,"name":"Olahra","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-218","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"olahra\u002F","parent_id":"94"},"219":{"id":"219","key":"hobi-olahra-sepeda-aksesoris","display_order":2,"name":"Sepeda&Aksesoris","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-219","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"sepeda-aksesoris\u002F","parent_id":"94"},"220":{"id":"220","key":"hobi-olahra-buku-majalah","display_order":5,"name":"Buku&Majalah","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-220","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"buku-majalah\u002F","parent_id":"94"},"221":{"id":"221","key":"hobi-olahra-koleksi","display_order":6,"name":"Koleksi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-221","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"koleksi\u002F","parent_id":"94"},"222":{"id":"222","key":"hobi-olahra-handicrafts","display_order":3,"name":"Handicrafts","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-222","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"handicrafts\u002F","parent_id":"94"},"223":{"id":"223","key":"hobi-olahra-mainan-hobi","display_order":7,"name":"MainanHobi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-223","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"mainan-hobi\u002F","parent_id":"94"},"224":{"id":"224","key":"perlengkapan-bayi-anak-perlengkapan-bayi","display_order":1,"name":"PerlengkapanBayi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-224","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perlengkapan-bayi\u002F","parent_id":"96"},"226":{"id":"226","key":"jasa-lowongan-kerja-lowongan","display_order":0,"name":"Lowongan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"Rp{salary_from}-{salary_to}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lowongan\u002F","parent_id":"97"},"227":{"id":"227","key":"jasa-lowongan-kerja-cari-pekerjaan","display_order":1,"name":"CariPekerjaan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"Rp{salary_from}-{salary_to}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"cari-pekerjaan\u002F","parent_id":"97"},"228":{"id":"228","key":"jasa-lowongan-kerja-jasa","display_order":2,"name":"Jasa","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"Rp{salary_from}-{salary_to}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"jasa\u002F","parent_id":"97"},"229":{"id":"229","key":"keperluan-pribadi-fashion-pria","display_order":2,"name":"FashionPria","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-229","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"fashion-pria\u002F","parent_id":"98"},"230":{"id":"230","key":"keperluan-pribadi-fashion-wanita","display_order":1,"name":"FashionWanita","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-230","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"fashion-wanita\u002F","parent_id":"98"},"231":{"id":"231","key":"keperluan-pribadi-jam-tangan","display_order":3,"name":"JamTangan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-231","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-price","desc-price","asc-distance"],"default":"desc-relevance"},"slug":"jam-tangan\u002F","parent_id":"98"},"232":{"id":"232","key":"keperluan-pribadi-perhiasan","display_order":5,"name":"Perhiasan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-232","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perhiasan\u002F","parent_id":"98"},"233":{"id":"233","key":"keperluan-pribadi-make-up-parfum","display_order":6,"name":"MakeUp&Parfum","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-233","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"make-up-parfum\u002F","parent_id":"98"},"234":{"id":"234","key":"keperluan-pribadi-perawatan","display_order":8,"name":"Perawatan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-234","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perawatan\u002F","parent_id":"98"},"235":{"id":"235","key":"hobi-olahra-hewan-peliharaan","display_order":9,"name":"HewanPeliharaan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-235","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-price","desc-price","asc-distance"],"default":"desc-relevance"},"slug":"hewan-peliharaan\u002F","parent_id":"94"},"4662":{"id":"4662","key":"mobil-bus","display_order":9,"name":"Truk&KendaraanKomersial","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"{m_year}","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"truk-kendaraan-komersial\u002F","parent_id":"86"},"4759":{"id":"4759","key":"mobil-spare-part","display_order":5,"name":"SparePart","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4759","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"spare-part\u002F","parent_id":"86"},"4760":{"id":"4760","key":"mobil-aksesoris","display_order":3,"name":"Aksesori","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4760","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"aksesori\u002F","parent_id":"86"},"4761":{"id":"4761","key":"mobil-velg-dan-ban","display_order":6,"name":"VelgdanBan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4761","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"velg-dan-ban\u002F","parent_id":"86"},"4762":{"id":"4762","key":"mobil-audio-mobil","display_order":4,"name":"AudioMobil","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4762","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"audio-mobil\u002F","parent_id":"86"},"4822":{"id":"4822","key":"motor-spare-part","display_order":5,"name":"SparePart","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4822","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"spare-part\u002F","parent_id":"87"},"4823":{"id":"4823","key":"motor-aksesoris","display_order":3,"name":"Aksesoris","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4823","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"aksesoris\u002F","parent_id":"87"},"4824":{"id":"4824","key":"motor-helm","display_order":4,"name":"Helm","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4824","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"helm\u002F","parent_id":"87"},"4827":{"id":"4827","key":"properti-tanah","display_order":30,"name":"Tanah","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4827","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"tanah\u002F","parent_id":"88"},"4833":{"id":"4833","key":"properti-indekos","display_order":40,"name":"Indekos","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4833","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"indekos\u002F","parent_id":"88"},"4835":{"id":"4835","key":"rumah-tangga-furniture","display_order":1,"name":"Mebel","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4835","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"mebel\u002F","parent_id":"89"},"4836":{"id":"4836","key":"rumah-tangga-dekorasi-rumah","display_order":2,"name":"DekorasiRumah","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4836","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"dekorasi-rumah\u002F","parent_id":"89"},"4841":{"id":"4841","key":"rumah-tangga-jam","display_order":4,"name":"Jam","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4841","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"jam\u002F","parent_id":"89"},"4842":{"id":"4842","key":"rumah-tangga-konstruksi-dan-taman","display_order":3,"name":"KonstruksidanTaman","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4842","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"konstruksi-dan-taman\u002F","parent_id":"89"},"4843":{"id":"4843","key":"rumah-tangga-lain-lain","display_order":99,"name":"Lain-lain","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4843","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lain-lain\u002F","parent_id":"89"},"4844":{"id":"4844","key":"rumah-tangga-lampu","display_order":5,"name":"Lampu","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4844","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lampu\u002F","parent_id":"89"},"4845":{"id":"4845","key":"rumah-tangga-makanan-minuman","display_order":0,"name":"Makanan&Minuman","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4845","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"makanan-minuman\u002F","parent_id":"89"},"4846":{"id":"4846","key":"kantor-industri-mesin-keperluan-industri","display_order":2,"name":"Mesin&KeperluanIndustri","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4846","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"mesin-keperluan-industri\u002F","parent_id":"90"},"4852":{"id":"4852","key":"kantor-industri-stationery","display_order":3,"name":"Stationery","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4852","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"stationery\u002F","parent_id":"90"},"4853":{"id":"4853","key":"kantor-industri-lain-lain","display_order":99,"name":"Lain-lain","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4853","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lain-lain\u002F","parent_id":"90"},"4952":{"id":"4952","key":"elektronik-gadget-lampu","display_order":7,"name":"Lampu","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4952","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lampu\u002F","parent_id":"92"},"4964":{"id":"4964","key":"hobi-olahra-barang-antik","display_order":4,"name":"BarangAntik","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4964","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"barang-antik\u002F","parent_id":"94"},"4975":{"id":"4975","key":"hobi-olahra-musik-film","display_order":8,"name":"Musik&Film","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-4975","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"musik-film\u002F","parent_id":"94"},"5046":{"id":"5046","key":"perlengkapan-bayi-anak-buku-anak-anak","display_order":3,"name":"BukuAnak-anak","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5046","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"buku-anak-anak\u002F","parent_id":"96"},"5047":{"id":"5047","key":"perlengkapan-bayi-anak-lain-lain","display_order":99,"name":"Lain-lain","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5047","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lain-lain\u002F","parent_id":"96"},"5048":{"id":"5048","key":"perlengkapan-bayi-anak-perlengkapan-ibu-bayi","display_order":2,"name":"PerlengkapanIbuBayi","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5048","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perlengkapan-ibu-bayi\u002F","parent_id":"96"},"5049":{"id":"5049","key":"perlengkapan-bayi-anak-pakaian","display_order":0,"name":"Pakaian","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5049","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"pakaian\u002F","parent_id":"96"},"5053":{"id":"5053","key":"perlengkapan-bayi-anak-stroller","display_order":5,"name":"Stroller","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5053","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"stroller\u002F","parent_id":"96"},"5090":{"id":"5090","key":"kantor-industri-perlengkapan-usaha","display_order":1,"name":"PerlengkapanUsaha","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5090","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"perlengkapan-usaha\u002F","parent_id":"90"},"5095":{"id":"5095","key":"keperluan-pribadi-pakaian-olahra","display_order":4,"name":"PakaianOlahra","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5095","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"pakaian-olahra\u002F","parent_id":"98"},"5123":{"id":"5123","key":"keperluan-pribadi-terapi-pengobatan","display_order":7,"name":"Terapi&Pengobatan","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5123","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"terapi-pengobatan\u002F","parent_id":"98"},"5124":{"id":"5124","key":"keperluan-pribadi-lainnya","display_order":10,"name":"Lainnya","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5124","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"lainnya\u002F","parent_id":"98"},"5126":{"id":"5126","key":"keperluan-pribadi-nutrisi-suplemen","display_order":9,"name":"Nutrisi&Suplemen","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5126","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"nutrisi-suplemen\u002F","parent_id":"98"},"5142":{"id":"5142","key":"perlengkapan-bayi-anak-boneka-mainan-anak","display_order":3,"name":"Boneka&MainanAnak","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":12,"b2c":0},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5142","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"boneka-mainan-anak\u002F","parent_id":"96"},"5154":{"id":"5154","key":"properti-sale-commercial","display_order":50,"name":"Dijual:BangunanKomersil","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5154","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"dijual-bangunan-komersil\u002F","parent_id":"88"},"5156":{"id":"5156","key":"properti-rent-commercial","display_order":60,"name":"Disewakan:BangunanKomersil","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"card-info-tpl-5156","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"disewakan-bangunan-komersil\u002F","parent_id":"88"},"5158":{"id":"5158","key":"properti-sale-houses-apartments","display_order":10,"name":"Dijual:Rumah&Apartemen","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"{p_bedroom}KT-{p_bathroom}KM-{p_sqr_building}m2","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"dijual-rumah-apartemen\u002F","parent_id":"88"},"5160":{"id":"5160","key":"properti-rent-houses-apartments","display_order":20,"name":"Disewakan:Rumah&Apartemen","search_allowed":true,"adding_allowed":true,"max_photos":{"c2c":20,"b2c":20},"min_photos":{"c2c":1,"b2c":1},"default_layout":"list","card_info_template":"{p_bedroom}KT-{p_bathroom}KM-{p_sqr_building}m2","default_location_level":"CITY","sorting":{"options":["desc-relevance","desc-creation","asc-distance","asc-price","desc-price"],"default":"desc-relevance"},"slug":"disewakan-rumah-apartemen\u002F","parent_id":"88"}},"errorsMetadata":{},"metadataKey":"categories"},"config":{"collections":{"config#\u002Fapi\u002Fconfig\u002Fgeneral":{"advertising":{"android":"\u002F\u002FID_android","desktop":"\u002F\u002FID_desktop","ios":"\u002F\u002FID_ios","mobile":"\u002F\u002FID_mobile"},"buyers":{"classified_config":{"lamudi_banner":{"offset_position":2,"ime":":\u002F\u002Fstatics.olx.co.id\u002Folxid\u002Flamudi_branding\u002Flamudi-banner.app.png","url":"","sticky_banner_enabled":false,"sticky_banner_ime":"","sticky_banner_url":""},"lamudi_banner_adp":{"ime":":\u002F\u002Fstatics.olx.co.id\u002Folxid\u002Flamudi_branding\u002Flamudi-banner.app.png","url":""}},"features":[{"brand_promise":{"en":{"olx_autos":{"header_Text":"QualifiedUsedCars","items":[{"title":"CarWarranty*","subtitle":"Get30-dayenginewarranty","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Money-backGuarantee","subtitle":"Enjoy7daysmoneybackguarantee","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"HomeTestDrive*","subtitle":"Relaxandtest-driveyourcarfromhome","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"FreeMaintenance","subtitle":"Freeserviceupto30,000kmorafter18months","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]},"franchise":{"header_Text":"QualifiedUsedCars","items":[{"title":"CarWarranty","subtitle":"Get30-dayenginewarranty","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Money-backGuarantee","subtitle":"Enjoy7daysmoneybackguarantee","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"HomeTestDrive","subtitle":"Relaxandtest-driveyourcarfromhome","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"FreeMaintenance","subtitle":"Freeserviceupto30,000kmorafter18months","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]},"default":{"header_Text":"QualifiedUsedCars","items":[{"title":"CarWarranty","subtitle":"Get30-dayenginewarranty","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Money-backGuarantee","subtitle":"Enjoy7daysmoneybackguarantee","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"HomeTestDrive","subtitle":"Relaxandtest-driveyourcarfromhome","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"FreeMaintenance","subtitle":"Freeserviceupto30,000kmorafter18months","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]}},"id-ID":{"olx_autos":{"header_Text":"PusatnyaMobilBekasBerkualitas","items":[{"title":"Mobilbergaransi","subtitle":"Jaminangaransimesinhingga30hari","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Jaminanuangkembali","subtitle":"Nikmati7harijaminanuangkembali","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"Testdrivedarirumah","subtitle":"Nikmatinyamannyatestdrivedarirumah","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"GratisPerawatan","subtitle":"Gratisperawatanhingga30,000kmatau18bulan","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]},"franchise":{"header_Text":"PusatnyaMobilBekasBerkualitas","items":[{"title":"Mobilbergaransi","subtitle":"Jaminangaransimesinhingga30hari","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Jaminanuangkembali","subtitle":"Nikmati7harijaminanuangkembali","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"Testdrivedarirumah","subtitle":"Nikmatinyamannyatestdrivedarirumah","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"GratisPerawatan","subtitle":"Gratisperawatanhingga30,000kmatau18bulan","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]},"default":{"header_Text":"PusatnyaMobilBekasBerkualitas","items":[{"title":"Mobilbergaransi","subtitle":"Jaminangaransimesinhingga30hari","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_brand_promise_$width$.$ext$"},{"title":"Jaminanuangkembali","subtitle":"Nikmati7harijaminanuangkembali","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_brand_promise_$width$.$ext$"},{"title":"Testdrivedarirumah","subtitle":"Nikmatinyamannyatestdrivedarirumah","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FhomeInspection_brand_promise_$width$.$ext$"},{"title":"GratisPerawatan","subtitle":"Gratisperawatanhingga30,000kmatau18bulan","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FfreeMaintenance_brand_promise_$width$.$ext$"}]}}},"brand_t":{"en":{"franchise":{"displayText":"AuthorizedDealer"}},"id-ID":{"franchise":{"displayText":"AuthorizedDealer"}}},"value_added_services":{"en":{"warranty":{"title":"CarWarranty*","subtitle":"Upto30daysenginewarranty","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_focused_$width$.$ext$"},"inspected_car":{"title":"InspectedCar","subtitle":"Thiscarhasbeeninspectedbyourexpertteam","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fcar_inspected_$width$.$ext$","focusedImeURI":null},"verified_seller":{"title":"VerifiedSeller","subtitle":"Wehereviewedthisseller'sidentitydocument","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fverified_seller_$width$.$ext$","focusedImeURI":null},"olx_autos":{"title":"OLXAutosJualBeliTukarTambah","subtitle":"CuratedbyOLXAutos","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Folx_autos_$width$.$ext$","focusedImeURI":null},"franchise":{"title":"$dealer_name","subtitle":"OLXAutosAuthorizedDealer","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Folx_autos_$width$.$ext$","focusedImeURI":null},"moneyback":{"title":"Money-backGuarantee","subtitle":"Enjoy7daysmoneybackguarantee","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_focused_$width$.$ext$"},"home_test_drive":{"title":"HomeTestDrive*","subtitle":"Relaxandtest-driveyourcarfromhome","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ftestdrive_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ftestdrive_focused_$width$.$ext$"},"free_maintenance":{"title":"FreeMaintenance","subtitle":"Freeserviceupto30,000kmorafter18months","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ffree_maintenance_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ffree_maintenance_focused_$width$.$ext$"}},"id-ID":{"warranty":{"title":"Mobilbergaransi*","subtitle":"Jaminangaransimesinhingga30hari","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fwarranty_focused_$width$.$ext$"},"inspected_car":{"title":"Mobillulusinspeksi","subtitle":"Kondisimobilsudahdiinspeksiolehtimahli","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fcar_inspected_$width$.$ext$","focusedImeURI":null},"verified_seller":{"title":"PenjualTerverifikasi","subtitle":"Dokumenidentitaspenjualtelahdiperiksa","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fverified_seller_$width$.$ext$","focusedImeURI":null},"olx_autos":{"title":"OLXAutosJualBeliTukarTambah","subtitle":"PilihanOLXAutos","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Folx_autos_$width$.$ext$","focusedImeURI":null},"franchise":{"title":"$dealer_name","subtitle":"OLXAutosAuthorizedDealer","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Folx_autos_$width$.$ext$","focusedImeURI":null},"moneyback":{"title":"Jaminanuangkembali","subtitle":"Nikmati7harijaminanuangkembali","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Fmoneyback_focused_$width$.$ext$"},"home_test_drive":{"title":"Testdrivedarirumah*","subtitle":"Nikmatinyamannyatestdrivedarirumah","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ftestdrive_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ftestdrive_focused_$width$.$ext$"},"free_maintenance":{"title":"GratisPerawatan","subtitle":"Gratisservicehingga30,000kmatau18bulansetelahnya","imeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ffree_maintenance_$width$.$ext$","focusedImeURI":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002Ffree_maintenance_focused_$width$.$ext$"}}}}],"personalised_filter_tooltip_duration":null},"features":[{"enabled":false,"name":"vkontakte","params":{}},{"enabled":true,"name":"mandatory_login","params":{}},{"data":{"service_unailable":true},"enabled":false,"name":"facebook_login","params":{}},{"enabled":true,"name":"email_login","params":{}},{"enabled":true,"name":"phone_login","params":{}},{"enabled":false,"name":"digits_login","params":{}},{"enabled":false,"name":"vkontakte_login","params":{}},{"enabled":true,"name":"google_login","params":{}},{"enabled":true,"name":"facebook_verification","params":{}},{"enabled":false,"name":"digits_verification","params":{}},{"enabled":true,"name":"phone_verification","params":{}},{"enabled":false,"name":"vkontakte_verification","params":{}},{"enabled":true,"name":"google_verification","params":{}},{"enabled":true,"name":"monetizer","params":{}},{"enabled":false,"name":"monetizer_wallet","params":{}},{"enabled":false,"name":"ask_review","params":{}},{"enabled":true,"name":"challenges_phone_login","params":{}},{"enabled":true,"name":"challenges_link_account","params":{}},{"enabled":true,"name":"lister_verification_sms","params":{}},{"enabled":true,"name":"dr_strange","params":{}},{"enabled":false,"name":"terms_gdpr","params":{}},{"enabled":false,"name":"public_phone_verification","params":{}},{"data":{},"enabled":false,"name":"fraud_warning","params":{}},{"enabled":false,"name":"phone_whitelisting","params":{}},{"data":{"aorConsent":true,"buyerRules":null,"docs":[{"type":"ktp","label":"KTP"},{"type":"passport","label":"Passport"}],"kycFlow":{"steps":[{"position":1,"type":"selfie","step":"SELFIE"},{"position":2,"type":"docs","step":"ID_FRONT"}]},"rules":[{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""},{"category_id":"198","city_id":""}],"showOnboarding":true},"enabled":false,"name":"kyc","params":{}}],"home_banner":null,"location":{"additionalLocale":[],"country":{"advertising_api_domain":"","allowed_domains":["api.olx.co.id",""],"api_domain":"api.olx.co.id","brand":"olxid","calling_code":"+62","chat_api_domain":"xchat.olx.co.id","chat_domain":"chat.olx.co.id:5222","ctx_api_domain":"api.olx.co.id","iso_code":"id","legal_terms":":\u002F\u002Fhelp.olx.com\u002Fhc\u002Fen-us\u002Fcategories\u002F1-Legal-Privacy-information","map_center":{"lat":-6.,"lng":106.,"zoom":14},"name":"Indonesia","posting_address_example":"","privacy_links":null,"protocol":"","reskinning_learn_more_url":":\u002F\u002Fnewlook.olx.co.id","site_code":"olxid","statics_domain":"statics.olx.co.id","zendesk_url":":\u002F\u002Fhelp.olx.co.id\u002Fhc\u002Fen-us"},"currencies":[{"iso_4217":"IDR","post":"","pre":"Rp","multiplier":1,"is_default":true}],"inspection_cities":[{"code":"BAL","id":[]},{"code":"BDG","id":[,]},{"code":"JAB","id":[,,,,,,,,]},{"code":"JOG","id":[]},{"code":"MDN","id":[]},{"code":"SBY","id":[,]},{"code":"SMG","id":[]}],"label_experiments":{"onboarding_primary_cta":"near_me","onboarding_secondary_cta":"other_address"},"locale":"id_ID","locales":[{"locale":"id-ID","formatting_locale":"id-ID","name":"BahasaIndonesia","is_default":true},{"locale":"en","formatting_locale":"en","name":"English"}],"separators":{"decimal":",","thousand":"."}},"notification_hub":{"url":":\u002F\u002Fapi.olx.co.id"},"protected_urls_spec":{"^\u002Fapi\u002Fv1\u002Faccount\u002F?$":["POST"],"^\u002Fapi\u002Fv1\u002Fchallenges\u002Fvalidate\u002F?$":["POST"],"^\u002Fapi\u002Fv1\u002Fitems\u002F?$":["POST"],"^\u002Fapi\u002Fv2\u002Fitems\u002F?$":["POST"],"^\u002Fapi\u002Fv1\u002Fusers\u002F[^\u002F]+\u002F?$":["GET"],"^\u002Fv1\u002Fauth\u002Fauthenticate\u002F?$":["POST"],"^\u002Fv2\u002Fauth\u002Fauthenticate\u002F?$":["POST"]},"rules":{"description":{"max_length":{"messe":"Cannotbelongerthan4096characters","value":4096},"min_length":{"messe":"Cannotbeshorterthan20characters","value":20}},"imes":{"max_length":{"value":12,"messe":"Imelimitexceeded"},"max_ratio":{"value":2.3333,"messe":"Invalidimeratio.Maxallowed:21:9"},"min_size_width":{"value":360,"messe":"Imeistoosmall(min100x100px)"},"min_size_height":{"value":360,"messe":"Imeistoosmall(min100x100px)"}},"person":{"min_length":{"value":1,"messe":"Cannotbeshorterthan1characters"},"max_length":{"value":100,"messe":"Cannotbelongerthan100characters"}},"phone":{"min_length":{"value":9,"messe":"Cannotbeshorterthan9characters"},"max_length":{"value":12,"messe":"Cannotbelongerthan12characters"}},"title":{"min_length":{"value":15,"messe":"Cannotbeshorterthan15characters"},"max_length":{"value":70,"messe":"Cannotbelongerthan70characters"},"contains_phone":{"value":7,"messe":"Titlecannotcontainaphone."},"contains_email":{"value":"","messe":"Titlemustnotcontainanemailaddress."},"contains_url":{"value":"","messe":"TitlemustnotcontainaURL."}}},"users":{"consentData":null}}},"isFetching":{"config#\u002Fapi\u002Fconfig\u002Fgeneral":false},"isError":{},"collectionMetadata":{"config#\u002Fapi\u002Fconfig\u002Fgeneral":{}},"elements":{},"errorsMetadata":{},"metadataKey":"locations"},"consumePacke":{"isFetching":false},"locations":{"collections":{"locations#\u002Fapi\u002Flocations#levels=country":[]},"isFetching":{"locations#\u002Fapi\u002Flocations#levels=country":false},"isError":{"locations#\u002Fapi\u002Flocations#levels=country":false},"collectionMetadata":{"locations#\u002Fapi\u002Flocations#levels=country":{}},"elements":{"":{"id":,"name":"Indonesia","type":"COUNTRY","longitude":106.,"latitude":-6.}},"errorsMetadata":{},"locations":{},"startingLocation":,"countryId":,"selectedLocation":{"id":,"name":"Indonesia","type":"COUNTRY","longitude":106.,"latitude":-6.},"gps":{"currentLocation":false,"isFetching":false,"status":null,"location":{}},"siLocation":{}},"messes":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"messes"},"monetizer":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"monetizers","validation":{},"errorMesse":{}},"maps":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{}},"loginModalState":null,"toastMesseState":null,"fileManerState":null,"toggleFilters":null,"toggleFiltersTanak":{"open":false,"selectedFilterId":null},"toggleUnreadNotifications":false,"toggleUnreadChats":null,"toggleSorting":null,"toggleProfileCompletion":{"show":false,"origin":""},"visualizationType":"","track":{"browsingMode":"","origin":"home","filters":{},"filtersMetadata":{"filters_applied_price":false,"filters_applied_map":false,"filters_applied_specific":0},"selectFrom":"","landingURL":"","autosPeName":""},"interventions":null,"interventionsData":null,"chat":null,"sendIntervention":null,"chatImesData":null,"resetLocation":false,"notifications":{"data":[],"metadata":{},"isFetching":false,"isError":false},"notificationsPreferences":{"data":{},"isFetching":false,"isError":false},"autocomplete":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"suggestions","lastCollectionUrl":""},"chatServiceStatus":true,"sitemap":{"states":[],"cities":[],"categories":[],"topSearches":{},"fetchingTopSearches":{}},"seo":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{}},"seoFooterLinks":{"collections":{},"isFetching":{"seo_footer_links#\u002Fapi\u002Fseo\u002Ffooter#sitecode=olxid":false},"isError":{"seo_footer_links#\u002Fapi\u002Fseo\u002Ffooter#sitecode=olxid":false},"collectionMetadata":{},"elements":{"\u002Fapi\u002Fseo\u002Ffooter?siteCode=olxid&lang=id-ID":{"sections":[{"title":"KategoriPopuler","links":[{"title":"MobilBekas","href":"\u002Fmobil-bekas_c198"},{"title":"Rumah&Apartemen","href":"\u002Fdijual-rumah-apartemen_c5158"},{"title":"MotorBekas","href":"\u002Fmotor-bekas_c200"},{"title":"Handphone","href":"\u002Fhandphone_c208"}],"id":"popular-categories"},{"title":"PencarianPopuler","links":[{"title":"Tablet","href":"\u002Ftablet_c209"},{"title":"FashionWanita","href":"\u002Ffashion-wanita_c230"},{"title":"FashionPria","href":"\u002Ffashion-pria_c229"},{"title":"Furniture","href":"\u002Ffurniture_c4835"}],"id":"popular-locations"},{"title":"OLXIndonesia","links":[{"title":"OLXKarir","href":":\u002F\u002F\u002Fsearch\u002Fall-functions\u002Findonesia-jakarta\u002Fall-brands"},{"title":"OLXNews","href":":\u002F\u002Fnews.olx.co.id?utm_source=pwa&utm_medium=footer"},{"title":"JualMobilInstan","href":":\u002F\u002F?utm_source=olx&utm_medium=referral&utm_campaign=link_olxsite_w"},{"title":"PusatKreditdanGadai","href":":\u002F\u002Fcatchadeal.id\u002F?utm_source=olx&utm_medium=backlink&utm_campaign=olx-backlink"},{"title":"LayananInspeksiMobil","href":":\u002F\u002Finspeksimobil.olx.co.id?utm_source=pwa&utm_medium=homepe_banner"}],"id":"popular-searches"},{"title":"OLX","links":[{"title":"TentangOLXGroup","href":":\u002F\u002F\u002F"},{"title":"PusatBantuan","href":":\u002F\u002Fhelp.olx.co.id\u002Fhc\u002Fid"},{"title":"PetaSitus","href":"\u002Fsitemap\u002Fmost-popular"},{"title":"KebijakanPrivasi","href":":\u002F\u002Fhelp.olx.co.id\u002Fhc\u002Fid\u002Farticles\u002F6-Kebijakan-Privasi"},{"title":"TipsAman","href":":\u002F\u002Ftipsaman.olx.co.id\u002F?utm_source=pwa&utm_medium=footer"}],"id":"corporate-links"},{"title":"Ikutikami","links":[{"title":"Facebook","href":":\u002F\u002F\u002Folxid"},{"title":"Twitter","href":":\u002F\u002Ftwitter.com\u002FOLX_Indonesia"},{"title":"Instram","href":":\u002F\u002F\u002Folxindonesia\u002F"},{"title":"Youtube","href":":\u002F\u002F\u002Fchannel\u002FUCpK91QSVxobdc30JaTMvjJA"}],"id":"social-networks"},{"title":"ApplikasiOLX","links":[{"title":"Android","href":":\u002F\u002Fplay.google.com\u002Fstore\u002Fapps\u002Fdetails?id=com.app.tokobus.betterb&utm_source=footer_android&utm_medium=footer_banner&utm_campaign=footer"},{"title":"Apple","href":":\u002F\u002Fapps.apple.com\u002Fid\u002Fapp\u002Ftokobus-com\u002Fid0?utm_campaign=footer&utm_medium=footer_banner&utm_source=footer_ios"}],"id":"mobile-apps"},{"title":"Negara-negaralain","links":[{"title":"India","href":":\u002F\u002F\u002F"},{"title":"Pakistan","href":":\u002F\u002F\u002F"},{"title":"SouthAfrica","href":":\u002F\u002F\u002F"}],"id":"other-countries"}],"id":"\u002Fapi\u002Fseo\u002Ffooter?siteCode=olxid&lang=id-ID"}},"errorsMetadata":{}},"seoPopularSearches":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{}},"projects":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"reProjects","aditionalMetadataKeys":["title","nextPe","nextPeUrl","locationName","appliedFilters","locationFilter"]},"user":{"tokenInfo":{"expire":null}},"topSearches":{"list":{},"fetching":{}},"filtersPreferences":{},"routeChange":{"loading":false,"error":null},"imes":{"data":{},"isFetching":false,"isError":false},"leadFormConfig":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"leadFormConfig"},"addToHome":{"ailableA2HChrome":false,"ailableA2HChat":false,"ailableA2HAd":false,"isFirstMesseSend":false,"isFirstAd":false,"promptOrigin":null},"profileStatus":{"data":{},"isFetching":false,"isError":false},"cover":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{}},"reviews":{"data":{},"metadata":{},"isFetching":false,"isError":false},"reviewsRate":{"badReviews":{},"goodReviews":{},"excellentReviews":{},"badReviewsMeta":{},"goodReviewsMeta":{},"excellentReviewsMeta":{},"isFetching":false,"isError":false},"reviewsCounters":{"data":{},"isFetching":false,"isError":false},"nigationTree":{"isFetching":false,"isError":false,"data":[{"id":"86","name":"Mobil","sub_categories":[{"id":"198","name":"MobilBekas"},{"id":"4760","name":"Aksesori"},{"id":"4762","name":"AudioMobil"},{"id":"4759","name":"SparePart"},{"id":"4761","name":"VelgdanBan"},{"id":"4662","name":"Truk&KendaraanKomersial"}]},{"id":"88","name":"Properti","sub_categories":[{"id":"5158","name":"Dijual:Rumah&Apartemen"},{"id":"5160","name":"Disewakan:Rumah&Apartemen"},{"id":"4827","name":"Tanah"},{"id":"4833","name":"Indekos"},{"id":"5154","name":"Dijual:BangunanKomersil"},{"id":"5156","name":"Disewakan:BangunanKomersil"}]},{"id":"87","name":"Motor","sub_categories":[{"id":"200","name":"MotorBekas"},{"id":"4823","name":"Aksesoris"},{"id":"4824","name":"Helm"},{"id":"4822","name":"SparePart"}]},{"id":"97","name":"Jasa&LowonganKerja","sub_categories":[{"id":"226","name":"Lowongan"},{"id":"227","name":"CariPekerjaan"},{"id":"228","name":"Jasa"}]},{"id":"92","name":"Elektronik&Gadget","sub_categories":[{"id":"208","name":"Handphone"},{"id":"209","name":"Tablet"},{"id":"215","name":"AksesorisHP&Tablet"},{"id":"211","name":"Fotografi"},{"id":"214","name":"ElektronikRumahTangga"},{"id":"212","name":"Games&Console"},{"id":"213","name":"Komputer"},{"id":"4952","name":"Lampu"},{"id":"210","name":"TV&Audio,Video"}]},{"id":"94","name":"Hobi&Olahra","sub_categories":[{"id":"217","name":"Alat-alatMusik"},{"id":"218","name":"Olahra"},{"id":"219","name":"Sepeda&Aksesoris"},{"id":"222","name":"Handicrafts"},{"id":"4964","name":"BarangAntik"},{"id":"220","name":"Buku&Majalah"},{"id":"221","name":"Koleksi"},{"id":"223","name":"MainanHobi"},{"id":"4975","name":"Musik&Film"},{"id":"235","name":"HewanPeliharaan"}]},{"id":"89","name":"RumahTangga","sub_categories":[{"id":"4845","name":"Makanan&Minuman"},{"id":"4835","name":"Mebel"},{"id":"4836","name":"DekorasiRumah"},{"id":"4842","name":"KonstruksidanTaman"},{"id":"4841","name":"Jam"},{"id":"4844","name":"Lampu"},{"id":"202","name":"PerlengkapanRumah"},{"id":"4843","name":"Lain-lain"}]},{"id":"98","name":"KeperluanPribadi","sub_categories":[{"id":"230","name":"FashionWanita"},{"id":"229","name":"FashionPria"},{"id":"231","name":"JamTangan"},{"id":"5095","name":"PakaianOlahra"},{"id":"232","name":"Perhiasan"},{"id":"233","name":"MakeUp&Parfum"},{"id":"5123","name":"Terapi&Pengobatan"},{"id":"234","name":"Perawatan"},{"id":"5126","name":"Nutrisi&Suplemen"},{"id":"5124","name":"Lainnya"}]},{"id":"96","name":"PerlengkapanBayi&Anak","sub_categories":[{"id":"5049","name":"Pakaian"},{"id":"224","name":"PerlengkapanBayi"},{"id":"5048","name":"PerlengkapanIbuBayi"},{"id":"5142","name":"Boneka&MainanAnak"},{"id":"5046","name":"BukuAnak-anak"},{"id":"5053","name":"Stroller"},{"id":"5047","name":"Lain-lain"}]},{"id":"90","name":"Kantor&Industri","sub_categories":[{"id":"203","name":"PeralatanKantor"},{"id":"5090","name":"PerlengkapanUsaha"},{"id":"4846","name":"Mesin&KeperluanIndustri"},{"id":"4852","name":"Stationery"},{"id":"4853","name":"Lain-lain"}]}]},"hats":{"hatsailable":false},"posting":{"titleKeySuggestion":"manual","titleVariantSelected":"","isLoadingTitleSuggestion":false,"shuffledTitleSuggestions":[],"pricePredictionData":{},"suggestedPrice":""},"preNotification":{"preNotificationailable":false,"preNotificationCookie":false},"bannerCMC":{"form":{},"userData":{}},"api":{},"leadDownloads":{"prepationQueue":[],"failedQueue":[],"displayList":[],"requestInfo":{},"adRequestMapping":{},"showRequestExistModal":false,"showRequestExistInfo":{},"isFetching":{}},"canonicals":{"elements":{}},"bundles":{"isFetching":false,"updateBundles":true,"isError":false,"elements":{},"collections":[]},"locationOnboardingStatus":"default_val","filters":{"elements":{},"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"popularRangeUsed":{},"filterRecencyOrder":[]},"filtersAbundance":{},"campaigns":{"elements":{},"isFetching":{},"isError":{},"campaignsNotFound":{}},"serverContext":{},"cxeLayout":{"layouts":{},"isError":{},"isFetching":{},"tabName":"","registrationResponse":null,"isExist":false},"popularData":{"popularData":{},"isError":{},"isFetching":{}},"cxeBundles":{"elements":{},"collections":{}},"buyerIntent":{"filters":{"make":"","price":"","body_type":"","year":"","emi":""},"currentStep":1,"evaluationState":"INITIAL","carCount":0},"survey":{"surveyId":""},"bookAppointment":{"centres":{"elements":{},"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{}},"cmcCities":{"isFetching":false,"isError":false,"data":{}},"timeSlots":{"isFetching":false,"isError":false,"data":{},"fetchTimeSlotAndCentreForceFully":true},"postAppointment":{"isPosting":false,"isError":false,"data":{}},"existingAppointments":{"isFetching":false,"isError":false,"data":{}},"disclaimer":{"isFetching":false,"isError":false,"data":{}},"locationMapDetails":{"coordinates":null,"addressLine1":"","inspectionTypeailable":0,"isRescheduleFromMapPe":false},"centreTimings":{"isFetching":false,"isError":false,"data":{}}},"listingSlider":{},"inspectionConsent":{"inspectionConsentData":{},"isInspectionConsentFetching":true,"isInspectionSubmitting":false,"isInspectionPosting":false,"isPreviewAdSubmitting":false,"isCarRulesFetching":false,"carRules":{}},"valuationFlow":{"showAllCTA":true,"valuationFormFields":[],"isRegistrationUrlAPICalled":false,"valuationMakePairs":null},"vasSheet":{"isOpened":false},"selfInspection":{"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{},"elements":{},"errorsMetadata":{},"metadataKey":"selfInspection"},"financeConfig":null,"financeSetting":{"data":null,"isFetching":false,"isError":false},"olxAutos":{"make":{"isFetching":false,"isError":false,"data":[]},"model":{"elements":{},"collections":{},"isFetching":{},"isError":{},"collectionMetadata":{}},"popularBrands":{"isFetching":false,"isError":false,"data":[]}},"meetings":{"enabled":false,"b2c_meeting_benefits":{},"meeting_documents":{},"test_drive_info":{}},"adpv":{"spinCar":{"isLoading":false,"isError":false}},"widgetConfig":{},"l2p":{"isFetching":false,"error":{},"l2pData":{},"l2pAppRedirection":false}},config:{"theme":{"id":"olx","brand":"OLX","mainColor":"#002f34","icon":"icon-OLX"},"rtl":false,"location":{"accuracy":3},"breakpoint":768,"locationTree":{"showMoreafter":20},"geolocation":{"timeout":null},"plush":{"apiKey":"AIzaSyC9eVmygtU-66itWQV1MY6l9llLA95gs","authDomain":"api-project-7652.firebaseapp.com","databaseURL":":\u002F\u002Fapi-project-7652.firebaseio.com","projectId":"api-project-7652","storeBucket":"api-project-7652.appspot.com","messingSenderId":"7652","appId":"1:7652:web:34cc9bedbb1","measurementId":"G-R796Y07VYY"},"disablePlush":true,"nigationBarEnabled":true,"monetizer":{"enabled":true,"wallet":{"show":false,"buyCredits":false,"buyWithCredits":false,"payWithMoneyFlow":true},"listings":false,"packesToShow":3,"currency":{"pre":"Rs","post":""},"paymentProviders":["secured-by-ingenico.com","poweredbyglobalcollect.com"],"featurePackes":[{"name":"Plus","icon":null,"duration":[4,9]},{"name":"Super","icon":"Super","duration":[7,15]},{"name":"Premium","icon":"Premium","duration":[14,30]}],"limits":{"enabled":false},"multiCheckout":false,"isL2CategoryRequired":true,"enablePackeRenew":false,"isDefaultLocationPrefilled":true,"superApp":{"dealerReferrersList":[":\u002F\u002Fdealer.olxautos.co.id"]}},"fingerPrint":{"enabled":true},"login":{"resendCodeMethods":["phone"],"enableSessionMigrationCoreToLegion":true,"facebookAppId":"9882","googleClientId":"7652-dggu54ckkkbb7n0bmqkphjrtl755e9.apps.googleusercontent.com","countryCode":"+62","loginSmsPasswordEnabled":true,"enableLoginAfterMesse":true},"skipCreatePasswordScreen":true,"myads":{"showCallsStatistic":true,"markAsSoldOnDeletionFlow":{"enable":false}},"notificationHub":{"enabled":true,"limit":10,"lastUpdateDiff":},"adDetails":{"showCallButton":true,"showSmsButton":false},"profile":{"adsLimit":3,"allowUploadIme":true,"profileCompletionOnboarding":{"enabled":true},"showReviews":{"enabled":false}},"gdpr":{"enabled":false,"contentControl":{"enabled":false}},"sessionMigration":{"enabled":false,"queryName":"appautologin","cookieName":"remember_login","cookieMigrate":"migrate"},"badges":{"facebook":{"enabled":true,"iconNoValidate":"icon-FacebookProfile","iconValidate":"icon-FacebookProfileValidated"},"gplus":{"enabled":true,"iconNoValidate":"icon-GoogleProfile","iconValidate":"icon-GoogleProfileValidated"},"phone":{"enabled":true,"iconNoValidate":"icon-PhoneProfile","iconValidate":"icon-PhoneProfileValidated"}},"postValidations":{"imes":{"mandatory":true,"minLength":1,"maxLength":8},"title":{"mandatory":true,"minLength":5,"maxLength":70},"price":{"mandatory":true,"minLength":1,"maxLength":9}},"post":{"compression":{"enabled":true,"options":{"checkOrientation":true,"maxWidth":1080,"quality":0.7}},"addressKey":"postAddress","listerVerification":true,"userContactInformation":true,"enableMultiCurrency":false,"carCategory":"198","enableSphereLocation":true},"apolloEnabled":true,"categories":{"newCategorySuggest":false,"secondarySuggestions":false},"realImpressions":{"enabled":true,"limit":20},"autoComplete":{"enabled":true,"suggestionsLimit":5,"siteCode":"olxid"},"bannedReasons":{"users":[{"value":"spam","key":"report_profile_reason_4"},{"value":"fraud","key":"report_profile_reason_5"},{"value":"profilePicture","key":"report_profile_reason_1"},{"value":"threateningMe","key":"report_profile_reason_2"},{"value":"insultingMe","key":"report_profile_reason_3"},{"value":"other","key":"report_profile_reason_6"}],"items":[{"value":"badContent","key":"report_ad_reason_1"},{"value":"fraud","key":"report_ad_reason_2"},{"value":"duplicated","key":"report_ad_reason_3"},{"value":"sold","key":"report_ad_reason_4"},{"value":"other","key":"report_ad_reason_5"}]},"validations":{"password":"^(?=.*[0-9])(?=.*[a-zA-Z])[^]{6,}$","contains_phone_number":"(?:\\d+\\s*){value,}","contains_phone_number_in_user":"(?:\\d+\\s*){5,}","contains_url":"(*|http:\u002F\u002Fwww\\.|:\u002F\u002Fwww\\.|http:\u002F\u002F|:\u002F\u002F|:\u002F\u002F)","contains_email":"[a-zA-Z0-9._%+-]+@[a-zA-Z0-9.-]+\\.[a-zA-Z]{2,6}","min_3_characters":"^.{0,3}$","min_5_characters":"^.{1,5}$"},"preconnectURLs":[":\u002F\u002Fapollo-singapore.akamaized.net"],"disabledItemStatus":["outdated","rejected","pending","deleted"],"redirectedToNotFoundStatusForItems":["unconfirmed","removed_by_user","moderated","blocked","disabled","outdated","new","removed_by_moderator","limited","unpaid","sold","pending","removed_by_admin"],"defaultSorting":"desc-creation","enableVisualization":true,"enableLocationPersistence":false,"enableListingAMP":true,"enableGeoListingAMP":false,"itemPostPlaceholder":{"enabled":true,"listing":{"itemsBefore":6},"home":{"itemsBefore":5}},"firstTimeSafetyTip":true,"enablePnRHomeFeed":false,"chat":{"newChat":{"voiceData":{"enableVoiceRecording":true,"enableVoicePlayback":true,"voiceUploadUrl":":\u002F\u002Fxchat.olx.co.id\u002Fservice\u002Fvoice","hmacKey":"\u002Fservice\u002Fvoice","maxLength":40},"tracking":{},"pinatedQueueLength":50,"postNumberAPI":"\u002Fuser\u002Fdetails","pricingAPI":"\u002Fuser\u002Fpricing","questionsApi":"\u002Fuser\u002Fquestions","popularQuestionsCount":5,"name":"chat","host":"","env":"chat","maxMesses":200,"retryTime":,"retryTrail":3,"domain":"olxid","wsUrl":"wss:\u002F\u002Fmsg.olx.co.id\u002Fws\u002Fchat","hmacPwd":"ichei4Ieveing6u","APIDomain":":\u002F\u002Fxchat.olx.co.id","threadsAPI":"\u002Fuser\u002Fthreads","markImportantAPI":"\u002Fuser\u002Fthreads","queueLength":5,"myChatsApi":":\u002F\u002Fxchat.olx.co.id\u002Fuser\u002Fmesses","featureApi":":\u002F\u002Fxchat.olx.co.id\u002Fservice\u002Fstartup","userPreferences":"\u002Fuser\u002Fpreferences","featureApiHmacKey":"\u002Fservice\u002Fstartup","imgData":{"enableImgFeature":true,"imgUploadUrl":":\u002F\u002Fxchat.olx.co.id\u002Fservice\u002Fime","minSize":5120,"maxSize":,"hmacKey":"\u002Fservice\u002Fime"},"showSmsButton":true,"showCallHistory":true,"showSmsHistory":true}},"socialMeta":{"enabled":true,"facebookNumericId":"666","siteName":"OLXIndonesia","twitterPublisher":"@OLX_Indonesia"},"SEO":{"enabledTopSearchesSiteCodes":["olxza","olxpk","olxin","olxid","olxar","olxco","olxcr","olxec","olxsv","olxgt","olxpa","olxpy","olxeg","olxlb"],"daysBeforePermanentRedirection":28,"sitelinksSearchStructuredData":"slug","noindexListingThreshold":0,"noindexListingCategories":[],"canonicalRewriteCategories":{},"googleSiteVerification":"cx8A6ow89bPU7uYLAOEqxJDCVEKVicl3jCT_eQwJG7I","googleMerchantVerification":"lnjcTzBrF_zODMWk7t2xOuXX5yhnV80pO5B8mg9Wyzo","titleTemplate":"%s-OLX.co.id","defaultTitle":"OLXPusatnyaNge-Deal","defaultDescription":"OLXIndonesia,pusatjualbelionlineterbesardiIndonesia.Semuabarangadadisini,darihandphone,komputer,otomotif,fashionbahkanrumahdanlowongankerja.","useFakeLevelSlug":true,"lang":"id-ID","mystique":true,"schemas":{"itemSchema":{"switch":{"key":"item.category_id","values":{"97":"jobOffer","198":"car","200":"motorcycle","5158":"property","5160":"property","default":"product"}}},"jobOffer":{"baseSchema":"genericItem","@context":"http:\u002F\u002Fschema.org","@type":"JobPosting","title":"{{data.item.title}}","baseSalary":{"@type":"MonetaryAmount","currency":"{{schema.currency}}","minValue":"{{data.item.mappedParams.salary_from.value}}","maxValue":"{{data.item.mappedParams.salary_to.value}}","unitText":"{{data.item.mappedParams.salary_period.formatted_value}}"},"datePosted":"{{data.item.created_at}}","jobLocation":"{{schema.jobLocation}}","employmentType":"{{data.item.mappedParams.type.formatted_value}}","salaryCurrency":"{{schema.currency}}","validThrough":"{{data.item.valid_to}}"},"currency":"IDR","jobLocation":{"@type":"Place","address":"{{schema.address}}"},"address":{"@type":"PostalAddress","name":"{{data.location}}","addressRegion":"{{data.item.mappedLocation.state.name}}","addressLocality":"{{data.item.mappedLocation.city.name}}"},"mileeFromOdometer":{"@type":"QuantitativeValue","value":"{{data.item.mappedParams.milee.value}}","unitCode":"KM"},"genericItem":{"@context":"http:\u002F\u002Fschema.org","@type":"Product","name":"{{data.item.title}}","description":"{{data.item.description}}","ime":"{{data.item.imes.0.url}}"},"product":{"baseSchema":"genericItem","@type":"Product","offers":"{{schema.offer}}","sku":"{{data.item.id}}","brand":"{{data.item.mappedParams.make.formatted_value}}"},"offer":{"@type":"Offer","url":"{{data.url}}","priceCurrency":"{{data.item.price.value.currency.iso_4217}}","price":"{{!data.item.price.value.raw}}","itemCondition":":\u002F\u002Fschema.org\u002FUsedCondition","ailability":":\u002F\u002Fschema.org\u002FInStock","seller":"{{data.user.name}}","priceValidUntil":"{{data.item.valid_to}}","businessFunction":"{{schema.businessFunction}}"},"businessFunction":{"switch":{"key":"item.category_id","values":{"5158":"businessRent","5160":"businessRent","default":"businessSell"}}},"businessSell":"http:\u002F\u002Fpurl.org\u002Fgoodrelations\u002Fv1#Sell","businessRent":"http:\u002F\u002Fpurl.org\u002Fgoodrelations\u002Fv1#LeaseOut","vehicle":{"baseSchema":"product","brand":"{{data.item.mappedParams.make.formatted_value}}","model":"{{data.item.mappedParams.m_tipe.formatted_value}}","modelDate":"{{data.item.mappedParams.m_year.formatted_value}}","mileeFromOdometer":"{{schema.mileeFromOdometer}}"},"engineDisplacement":{"@type":"QuantitativeValue","value":"{{data.item.mappedParams.m_engine_capacity.formatted_value}}","unitCode":"CMQ"},"engineSpecification":{"@type":"EngineSpecification","engineDisplacement":"{{schema.engineDisplacement}}"},"car":{"@type":["Car","Product"],"baseSchema":"vehicle","fuelType":"{{data.item.mappedParams.m_fuel.formatted_value}}","ime":"{{data.item.imes.0.url}}","color":"{{data.item.mappedParams.m_color.formatted_value}}","bodyType":"{{data.item.mappedParams.m_body.formatted_value}}","vehicleTransmission":"{{data.item.mappedParams.m_transmission.formatted_value}}","vehicleEngine":"{{schema.engineSpecification}}","driveWheelConfiguration":"{{data.item.m_drivetrain.formatted_value}}"},"motorcycle":{"@type":["Motorcycle","Product"],"baseSchema":"vehicle"},"property":{"baseSchema":"product","@type":["{{schema.propertyType}}","Product"],"numberOfRooms":"{{data.item.mappedParams.p_bedroom.formatted_value}}","flOLX Pusatnya Nge-DealoorSize":"{{schema.floorSize}}","address":"{{data.location}}"},"propertyType":{"switch":{"key":"item.mappedParams.type.value","values":{"rumah":"house","apartemen":"apartment","default":"apartment"}}},"house":"House","apartment":"Apartment","floorSize":{"@type":"QuantitativeValue","unitCode":"SQM","value":"{{data.item.mappedParams.p_sqr_building.formatted_value}}"}},"sitemapBucket":":\u002F\u002Fpanamera-seo-sitemap-bucket-prd-ap-southeast-1.s3-ap-southeast-1.amazonaws.com"},"searchHeader":{"maxPopularCategories":4,"maxPopularLocations":4},"reProjects":{"showCarousel":false,"enableLeadForm":false},"phoneFormat":"*********","autocompleteVersion":"2.2","advertising":{"enabled":true,"baxterPath":"\u002Fbaxter\u002Fweb\u002F","fileExt":".min.js","host":":\u002F\u002Fapi.olx.co.id"},"categoryCover":{},"downloadApp":{"enabled":true,"links":{"android":":\u002F\u002Fplay.google.com\u002Fstore\u002Fapps\u002Fdetails?id=com.app.tokobus.betterb&utm_source=desktop_android&utm_medium=home_banner&utm_campaign=home","ios":":\u002F\u002Fapps.apple.com\u002Fid\u002Fapp\u002Folx-indonesia\u002Fid0?utm_source=desktop_ios&utm_medium=home_banner&utm_campaign=home"}},"gmaps":{"apiKey":"AIzaSyAChxbDof4fywIkC6U-7MCgXBpUp4t2DiA"},"bundles":{"enabled":true},"browsingModeEvents":{"view_item":true,"view_listings":true,"item_chat_tap_chat":true,"item_tap_call":true,"listings_results":true,"view_item_time":true,"listings_results_time":true,"inspected_car_icon":true,"item_tap_interested":true,"hp_tab_clicked":true,"widget_shown":true,"olxautos_widget_button_clicked":true,"olxautos_widgets_shown":true},"searchSuggestionsRetrivalWaitTime":300,"showAutosHomePeWidget":true,"enableAutoScrollListing":false,"adpvAuto":{"showSocialShareBtn":true,"showFBtn":true,"enableChat":true,"enableReportAd":true,"reportModal":true,"featuredT":true,"showNewDesign":true,"enable":true,"carCategory":"198","keys":{"model":"m_tipe","make":"make","year":"m_year","variant":"m_tipe_variant","fuel":"m_fuel","transmission":"m_transmission"},"fcgIdTMapping":{"bodyBonnet":"Bonnet","bodyFrontLeftDoor":"Doors","bodyFrontRightDoor":"Doors","bodyBackRightDoor":"Doors","bodyBackLeftDoor":"Doors","bodyTrunk":"Doors","bodyFrontBumper":"Bumpers","bodyRearBumper":"Bumpers","bodyFrontRightFender":"Fenders","bodyFrontLeftFender":"Fenders","bodyBackRightFender":"Fenders","bodyBackLeftFender":"Fenders","bodyRoof":"Others","bodyLeftAPillar":"Others","bodyLeftBPillar":"Others","bodyLeftCPillar":"Others","bodyRightAPillar":"Others","bodyRightBPillar":"Others","bodyRightCPillar":"Others","bodyFrontLeftDoorWindow":"Windows","bodyBackLeftDoorWindow":"Windows","bodyBackRightDoorWindow":"Windows","bodyFrontRightDoorWindow":"Windows","bodyRearWindscreen":"Windscreen","bodyFrontWindscreen":"Windscreen"},"carExtendedInspectedTUri":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FcarExtendedInspectedT_$width$.$ext$","carInspectedIconUri":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FcarInspected_$width$.$ext$","inspectionOkIconUri":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FokStatus_$width$.$ext$","inspectionNotokIconUri":"\u002Folxid\u002Fbuyers\u002Fitems\u002Fv1\u002Finspection\u002F$mode$\u002FerrorStatus_$width$.$ext$","showSpinCar":true},"superAppAutologin":{"enabled":true},"visualizationType":{"mobile":"list","desktop":"grid"},"hideVasTListing":false,"brandLogo":"\u002Fexternal\u002Fbase\u002Fimg\u002FolxAutos\u002Folxautos-blue-logo_$width$.$ext$","invertedBrandLogo":"\u002Fexternal\u002Fbase\u002Fimg\u002FolxAutos\u002Folxautos-coco-seller-profile-logo-$width$.$ext$","showSellerLinkAdpv":true,"ninjaLink":":\u002F\u002Fninja.data.olxcdn.com\u002Fninja-panamera.js","listing":{"errorFigure":"\u002Fexternal\u002Fbase\u002Fimg\u002FnoResults.$ext$"},"region":"mea","siteCode":"olxid","lang":"id","ppcColumns":["corporate-links"],"langs":[{"code":"id","dir":"ltr","name":"Indonesian"}],"host":":\u002F\u002F","clevertap":{"id":"TEST-Z6K-746-995Z"},"showFreeClassifieds":true,"countryCode":"id","categoryBrowsing":{"maxCategories":9},"exponea":{"enabled":true,"token":"2c4f2de8-9170-11e8-8823-0a580a201a47"},"redirectionTermsAndConditions":":\u002F\u002Fhelp.olx.co.id\u002Fhc\u002Fid\u002Farticles\u002F","categoryMapping":{"86":"vehicles","87":"motorbike","88":"realEstate","89":"furnitures","90":"printer","92":"electronics","94":"school","96":"babies","97":"jobs","98":"fashion"},"showCategoryBrowsingSubCategories":true,"bucketSize":5,"allCountry":505,"truecaller":{"appKey":"uO8Fd8c64ec5401caf9450d507c","appName":"OLXID","langueLocale":"en","LINK_TO_YOUR_PRIVACY_PE":"","LINK_TO_YOUR_TERMS_PE":"","TITLE_STRING_PREFIX":"","TITLE_STRING_SUFFIX":"","BUTTON_TEXT_PREFIX":"","BUTTON_FILL_COLOR":"","BUTTON_TEXT_COLOR":"","BUTTON_SHAPE":"","footerCtaString":"useanothernum"},"loginMethods":[{"name":"challenges_phone_login","enabled":true,"hash":"#loginsms"},{"name":"facebook_login","enabled":true},{"name":"google_login","enabled":true},{"name":"google_yolo","enabled":true},{"name":"email_login","enabled":true,"hash":"#loginemail"}],"loginWithEmailVerification":true,"socials":[{"name":"Facebook","track":"facebook","className":"facebook","url":":\u002F\u002F\u002Fdialog\u002Fshare?app_id=\u003C\u003CappId\u003E\u003E&display=popup&href=\u003C\u003Curl\u003E\u003E&redirect_uri=\u003C\u003Curl\u003E\u003E","icon":"icon-FacebookProfile","mobileOnly":false},{"name":"Messenger","track":"messenger","className":"fbMessenger","url":"fb-messenger:\u002F\u002Fshare\u002F?link=\u003C\u003Curl\u003E\u003E&app_id=666","icon":"icon-Messenger","mobileOnly":true},{"name":"Whatsapp","track":"whatsapp","className":"whatsapp","url":"whatsapp:\u002F\u002Fsend?text=\u003C\u003Ctext\u003E\u003E\u003C\u003Curl\u003E\u003E","icon":"icon-Whatsapp","mobileOnly":true}],"locationMapping":{"COUNTRY":"COUNTRY","ADMIN_LEVEL_1":"STATE","ADMIN_LEVEL_3":"CITY","SUBLOCALITY_LEVEL_1":"NEIGHBOURHOOD"},"suggestedCategories":["198","200","88","208","97","210"],"staticAssets":":\u002F\u002Fstatics.olx.co.id","longFiltersCategoryList":{"198":"40","4662":"40"},"showOlxAutosCarsSlider":true,"olxAutos":{"carCategory":"198","citiesForSi":[{"sphareName":"BALI","sphareId":""}],"inspectionCtaConfig":{"sectionToHideForNonMatchedCity":["book-an-appointment-section_v3"],"sectionToHideForMatchedCity":["book-an-appointment-section_v2"]},"SEOContent":{"sell":{"title":"JualmobillangsungdiOLXAutos-Belijualmobilbekas,cekhargamobilbekas","h1":"Jualmobildenganhargaterbaik","meta":"Jualmobilbekasdenganhargaterbaik.JualmobiltuadarikenyamananrumahataukunjungitokoOLXAutos&jualdalamsatukunjungan.Dapatkanpemeriksaanmobilgratis,transferRC&pembayaranbebasrepot"},"buy":{"title":"Platformjualbelimobilbekasterpercayadenganprosesyangcepat,mudahdanaman!","meta":"Pengecekanmobildilakukansecara100%gratisolehstafahliyangberpengalaman.Garansimesinhingga30haridan7hariuangkembali.Gratisperawatanmesindanoli.Melayanitestdrivedarirumah.BeliSekarang!"}},"onlyMobile":false,"urlKeywords":{"sell":"sell","buy":"beli","buyPPC":"buy"},"isHomePeWidgetized":false,"hideOrganicLayout":false,"contactUsPath":"contacto","hideUserEmailO2O":true,"categoryExtendedFooter":true,"tabsData":[{"title":"Jualmobilbekas","key":"SELL","urlKey":"sell-organic"},{"title":"Belimobilbekas","key":"BUY","urlKey":"buy-ppc"}],"nigationTabs":[{"title":"Jualmobilbekas","key":"SELL","urlKey":"sell-organic"},{"title":"Belimobilbekas","key":"BUY","urlKey":"buy-ppc"}],"showSubheaderTabs":true},"showO2OFlowInDesktop":true,"landingPeRoutes":{"sell-organic":"sell-car","buy-organic":"beli-mobil-bekas","buy-ppc":"buy-used-car","sell-ppc":"sell-my-car\u002Finstant-payment","sell-ppc-2":"olxautos"},"redirectToBuyLandingPe":{"isEnabled":true,"category":"198"},"showOlxAutosLogoOnCarCategory":true,"showOlxAutosSearchInputOnCarListingPe":true,"showDentMap":true,"isL2PTracker":true,"showNewSIVersion":true,"selfInspectionConfig":{"imeUploadConfig":{"maxRatio":{"messe":"Rasiogambartidakvalid.Maksimumyangdiizinkan:21:9.","value":2.},"minImeHeight":{"messe":"Gambarterlalukecil(min.100x100piksel).","value":100},"minImeWidth":{"messe":"Gambarterlalukecil(min.100x100piksel).","value":100}},"imeUrls":{"photoUpload":":\u002F\u002Fstatics.olx.in\u002Folxin\u002Fautos\u002Fself_inspection\u002Fcommon\u002FselfInspectionUploadPhoto.svg","siSuccess":":\u002F\u002Fstatics.olx.in\u002Folxin\u002Fautos\u002Fself_inspection\u002Fcommon\u002FselfInspectionSuccess.svg","siError":":\u002F\u002Fstatics.olx.in\u002Folxin\u002Fautos\u002Fself_inspection\u002Fcommon\u002FselfInspectionError.svg"},"configId":"IDSI0001","citySphareIds":[""]},"skipOtp":true,"alwaysPaidSource":["olxautos"],"lamudiBranding":{"mobileListingBannerIdx":2},"paidCampaign":{"alwaysPaidSource":["olxautos"]}},translations:{"_comment":"B2Q","imeFormatError":"Jenisgambartidakdidukung.Harapbikangambarjpeg\u002Fpng","noInternetError":"Ups!Andatidakmemilikikoneksi.","imeError":"Terjadikesalahansaatmengunggahgambar.Silakancobali.","maxImeUploadError":"Andahanyadapatmemilih{displayImeLimit}gambar.","blockUser":"BlokirPengguna","unblockUser":"BukaBlokirPengguna","cancel":"Batalkan","block":"Blokir","unblock":"Bukablokir","deleteChat":"HapusChat","ok":"Oke","deleteUserDialog":"Andayakininginmenghapus?","deleteMultipleChats":"HapusBeberapaChat","cancelOption":"Batalkan","dayso":"{dayDiff}hariyanglalu","sms":"SMS","unreadMesse":"{unreadCount}PesanBelumDibaca","unreadMesses":"{unreadCount}PesanBelumDibaca","incomingCall":"Nomordilihat","userOwnSmsMesse":"SMSdi","userOwnCallMesse":"Andamelihatangka{userName}pada","callMesse":"{userName}melihatnomorAndapada","smsMesse":"SMSdi","smsDefaultMsg":"SMSdi","callDefaultMsg":"{name}mencobamenghubungiAnda","loadMoreChats":"muatlainnya","messesUnailable":"Pesantidaktersedia","interventionMoreButton":"Lainnya...","fieldMinValue":"Penawaranharuslebihbesardaripada{value}","fieldMaxValue":"Penawaranharuslebihrendahdaripada{value}","chatSearchBox":"CaridalamChat","noSearchResults":"TidakAdaHasilPencarian","messeSearch":"PESAN","itemSearch":"PRODUK","userSearch":"PENGGUNA","deactivatedChatMsg":"IklantidakaktifChatakandihapusdalam{dayDiff}hari","deleteDeactivatedChat":"Hapus","deactivatedChatMsgToday":"Iklantidakaktif.Chatakandihapusdalamhariini","deactivatedChatMsgUser":"PenggunaTidakAktif.Chatakandihapusdalam{dayDiff}hari","deactivatedChatMsgTodayUser":"PenggunaTidakAktif.Chatakandihapusdalamhariini","deleteChatError":"Tidakdapatmenghapusobrolan.Harapcobalinanti!","chatSuccessfullyDeleted":"{deleteChatsCount}obrolanberhasildihapus!","chatsSuccessfullyDeleted":"{deleteChatsCount}obrolanberhasildihapus!","selectChats":"PilihObrolan","chats":"Chat","delete":"Hapus","filteredChatsMesse":"{filteredCount}{activeFilter}di{totalCount}obrolanterbaru,cobamuatlebihlanjut","all":"Semua","unread":"Belumdibaca","quickFilters":"FilterCepat","noFilteredChatsMesse":"Tidakadaobrolanberdasarkanpilihanfiltersaatini","noAllChats":"Andatidakmemilikiriwayatchatsejauhini.","noMeetingChats":"Andatidakmemilikiriwayatpertemuansejauhini.","noUnreadChats":"Hore!AndatelahmembacasemuapesanAnda.","noImportantChats":"Andatelahmenandaitidakadayangpentingsejauhini.","itemInactive":"Iklaninitelahdinonaktifkanolehpenjual","userInactive":"Penggunainitidakaktif","sellerAskingPrice":"HargayangDimintaPenjual","offerWorst":"Penawaranterlalurendah","offerWorstMesse":"PRODUKSERUPAYANGSESUAIANGGARANANDA.","offerGood":"PenawaranBus","offerGoodMesse":"Kemungkinanresponspenjualbertambah.","offerHigh":"PenawaranAndaterlalutinggi","offerHighMesse":"PenawaranAndaharuskurangdari{value}.","inputOffer":"Harapmasukkannilaipenawaran","inputOfferMesse":"Beripenawaranuntukmenyelesaikantransaksidengancepat!","offerRejectedMesse":"Penawaranharuslebihdari{value}.","offerVeryGood":"Penawaranyangsangatbus!","offerVeryGoodMesse":"Kemungkinanbalasanpenjualtinggi.","requestOffer":"MINTAPENAWARAN","editOfferCTA":"EDITPENAWARAN","makeNewOfferCTA":"BUATPENAWARANBARU","goAhead":"Marikitalanjutkan","letsMeet":"Ayobertemu","askContact":"MINTAKONTAK","betterOffer":"Berisayatawaranyanglebihbaik.","send":"Kirim","rejectModalHeader":"Pilihalasanuntuktidakmenerimapenawaran.","nextSteps":"LangkahSelanjutnya","offer":"Tawarkan","counterOfferRejectModal":"Hargaterakhirsayaadalah:","typePrice":"Ketikharga","okDone":"Oke,selesai!","enterPrice":"MasukkanHarga","buyerOfferHeader":"PenawaranPembeli:","sellerCounterOfferHeader":"PENAWARANBALASANPENJUAL:","yourOfferHeader":"PENAWARANANDA:","noBuyerOfferHeader":"BELUMADAPENAWARANDARIPEMBELI","offerreedHeader":"PENAWARANDITERIMA:","yourCounterOfferHeader":"PenawaranbalasanAnda","requestOfferBody":"Silakanbuatpenawaranterlebihdahuluuntukmenyelesaikantransaksilebihcepatdanmembeliprodukini.","counterOfferDescription":"Menungguresponspembeli","offerreedDescription":"SekarangAndaselangkahlebihdekatketransaksiakhir","requestOfferDescription":"Mintapenawaranuntukmenyelesaikantransaksidengancepat!","buyerMakeOfferDescription":"Menungguresponspenjual","buyerAskedBetterOfferDescription":"PenjualmenunggupenawaranbaruAnda","buyerCounterOfferDescription":"PenjualmenungguresponsAnda","sellerWaitingOfferDescription":"PembelimenungguresponsAnda","sellerWaitingBetterOfferDescription":"Andamemintapenawaranyanglebihbaik,menungguresponspembeli","accepted":"Diterapkan","letsMeetMesse":"Maribertemuuntukmenyelesaikantransaksidengancepat.","buyerOfferMesseHeader":"Penawaranpembeli","sellerOfferMesseHeader":"Penawaranpenjual","rejectOfferCTA":"MintaLebihBanyak","yourOfferMesseHeader":"PenawaranAnda","closeDeal":"Selesaikantransaksidengancepat!","appUpgradeChatMsg":"Pesantidakditampilkan!CobaperbaruiAplikasiAnda.","voiceSupportText":"Pesansuarabaruditerima.Perbaruiaplikasiuntukmendengarkan!","seller":"penjual","buyer":"pembeli","you":"Anda","reply":"Balas","autoAnswers":"JawabanOtomatis","autoReplyDescription":"OLXakansecaraotomatismenjawabpertanyaanatasnamaAnda,jikaAndamengaktifkannya,halyangsamaakantercerminuntuksemuapercakapanAnda.","chooseAnOption":"Pilihopsi","approvedDealer":"Dealeryangdisetujui","turnOff":"Matikan","autoReplyOnboardingHeader":"MatikanJawabanotomatis?","autoReplyOnboardingContent":"MematikanjawabanotomatisakanmematikanfituriniuntuksemuaobrolanAnda.Yakininginmematikanini?","turnItOff":"Matikan","keepItOn":"Biarkanmenyala","autoAnswerHeader":"JawabanOtomatis","autoAnswerContent":"KamitelahmengaktifkanfungsipenjawabotomatisuntukAnda.OLXakansecaraotomatismenjawabpertanyaanmewakiliAnda,halyangsamaakantercerminuntuksemuapercakapanAnda.","turnOn":"Aktifkan","autoReplyInboxCardDescription":"AktifkanfungsiJawabotomatisarOLXsecaraotomatismenjawabpertanyaanmewakiliAndauntuksemuaobrolanAnda.","autoReplyFlMesse":"Fungsionalitasjawabotomatissekarangberubahmenjadi{value}untuksemuaobrolanAnda.","markAsRead":"Tandaisebaisudahdibaca","markAsImportant":"Tandaisebaipenting","removeImportant":"Hapuspenting","important":"Penting","markImportantSuccess":"Menandaipercakapansebaipenting","removeImportantSuccess":"Menghapustandapercakapansebaipenting","markImportantError":"Tidakdapatmenandaipercakapansebaipenting","removeImportantError":"Tidakdapatmenghapustandapercakapansebaipenting","voicePermissionText":"Untukmulaimengirimpesansuara,berikanizinOLXuntukmengaksesmikrofonuntukperangkatAnda","voiceUploadError":"Terjadikesalahansaatmengunggahpesansuara.Silakancobali.","voicePermissionError":"Kamimemerlukanizininiuntukmengirimpesansuara.","voiceLoadError":"Kesalahan!!Saatmemutarmedia","voiceRecordingMesse":"Merekampesansuara","chatIsDownMesse":"Kamisedangmemperbaruisistem.Andamungkinmengalamibeberapamasalah","chatAllTab":"SEMUA","chatBuyingTab":"Membeli","chatSellingTab":"Menjual","defaultUserNameChat":"{brand}Pengguna","defaultAdTitleChat":"{brand}iklan","others":"Lainnya","done":"Selesai","numberPlatePlaceholder":"HR26XX7700","A2HChatTitle":"Janganlewatkanapapun","A2HChatDesc":"DapatkannotifikasisaatAndamendapatjawaban.TambahkanaksescepatkeOLX","A2HAdTitle":"Dapatkanpenawaranterbaik","A2HAdDesc":"AksescepatkeOLX,mudahdanringan.Dapatkannotifikasitanpamengunduhaplikasi.","offlineTitle":"Ups!SepertinyaAndaoffline","offlineText":"HarapperiksakoneksiinternetAndadancobali","seeWhy":"Lihatalasannya","footer":"IklanBarisGratisdi{country}","published":"IklanyangTerpasang","liked":"Forit","editProfile":"Editprofil","deletePhoto":"HapusFoto","following":"Following","followers":"Followers","memberSince":"Anggotasejak{date}","verifiedAccountTitle":"Akunverifikasi","at":"pada","and":"and","location":"Lokasi","msgBoxPlaceholder":"Tulispesan","addFriend":"Follow","removeFriend":"Unfollow","viewprofile":"LihatProfil","shareFriends":"Temanbersama","makeOffer":"BuatPenawaran","chat":"Chat","allowNotifications":"Izinkannotifikasi","confirmCTA":"Lihat\u002Fgantijadwalbooking","l2pTrackCTA":"LacakPemesanan","confirmInspection":"INSPEKSIDIKONFIRMASI","whatsapp":"Whatsapp","notifications":"Notifikasi","sendOffer":"Kirimpenawaran","friendsInCommon":"Temanbersama","noFriendsInCommon":"Tidakadatemanbersama","phone":"NomorteleponAnda","forgotPassword":"ApakahAndalupakatasandiAnda?","logIn":"Login\u002FDaftar","filters":"Filter","quoteAnotherCar":"Carimobillain","publishedNoAdsText":"Andabelummemasangiklan","publishedNoAdsSubText":"Jualbarangyangsudahtidakterpakai","filterAdsEmptyStateText":"Tidakadaiklanyangditemukan","likedNoAdsText":"Andabelummemilikiiklanforit","likedNoAdsSubText":"SimpaniklanyangKamusukadanbikandenganorang-orangsekitarKamu","selectEmptyOption":"Pilih{key}","password":"katasandi","loadMore":"muatlainnya","loading":"Memuat...","discover":"Telusuri","post":"PasangIklan","name":"Nama","about":"Tentangsaya(opsional)","update":"PerbaruiProfil","startSelling":"PasangIklan","help":"Bantuan","close":"Tutup","logout":"Logout","hello":"Halo","se":"Simpan","recentLocations":"Lokasiterkini","popularLocations":"Lokasipopuler","drawerMyAds":"IklanSaya","continues":"Lanjutkan","addPhotos":"Unggahhingga{limit}foto","carLabel":"Cari{label}mobil","searchHere":"Caridisini","categories":"Kategori","locations":"Lokasi","mostPopular":"PalingPopuler","states":"Wilayah","cities":"Kota","category":"Kategori","paymentErrorMsg":"Mmm...adayangtidakberes","popularCategories":"KategoriPopuler","sitemap":"Petalokasi","relatedSearches":"PencarianPopuler","add_details":"Sertakanbeberapadetail","add_photos":"Tambahkanfoto","how_much_cost":"Harga*","modify_category":"Ubah","mobile_phone":"NomorHandphone","posting_helpertext_title":"SebutkanfiturutamadaribarangAnda(misalmerek,model,umur,jenis)","posting_helpertext_desc":"Sertakankondisi,fitur,danalasanpenjualan","post_choose_category":"Pilihkategori","post_find_category":"Lanjut","post_post_your_ad":"PasangIklanAnda","post_now":"PasangIklanSekarang","selected_category":"KategoriTerpilih","uploading_your_ad":"MengunggahiklanAnda...","wait_uploading_your_ad":"IklanAndaakansiapsebentarli.Harapjangankeluardarilayarini.","what_you_selling":"Juduliklan","what_you_selling-1":"Tajuk","what_you_selling-2":"Pengantar","where_located":"KonfirmasikanlokasiiklanAnda","currency_type":"Jenismatauang","action_button_on_error":"Keberanda","posting_retry_text":"CobaliuntukmelanjutkanpostingiklanAnda","categorySelectionError":"Adayangtidakberes!PeriksajaringanAndadancobali!","all_text":"Semua","popular_text":"Populer","suggestion_text":"Saran","no_suggestion_text":"Tidakadasaranyangtersedia","inspection_report":"LaporanInspeksi","view_technical_reoprt":"LihatLaporanTeknis","inspection_thank_text":"Terimakasih!","inspection_heading_text":"armobilAndadiperiksadiOLXAutos.","inspection_sub_heading_text":"AndasekarangdapatmenunjukkanhasilinspeksipadaIKLANAndauntukpembeli","inspection_ad_link_text":"PeriksabaimanatampilanIKLANAnda","inspection_feature_1":"LebihbanyaktanggapandariPembeli","inspection_feature_2":"Balasanotomatiskepadapembeli","inspection_feature_3":"Hargalebihbaik","ignore_text":"Abaikan","congrats_text":"Selamat!","inspection_info_text":"DetailinspeksisekarangdapatdilihatpadaIKLANAnda.","view_ad_text":"LihatIklan","posting_retry_offline":"Mmm...adayangtidakberes.KamiakanmencobamempostingiklanAndabegituAndaonline","price_mandatory":"Hargawajibdiisi.Haraplengkapikolomyangdiperlukan.","price_max_error":"Hargamemilikinilaimaksimum","price_min_error":"Hargamemilikinilaiminimum","inspection_heading_text_new":"KonfirmasiuntukmenambahkanlaporaninspeksikeIklanAnda","inspection_feature_heading":"Iklandenganlaporaninspeksi","inspection_new_feature_1":"Dapatkanlebihbanyakresponsdaripembeli","inspection_new_feature_2":"Kurangipertanyaandalamobrolan","inspection_new_feature_3":"Dapatkanhargayanglebihbaik","inspection_preview_ad":"PratinjauiklanAndadisini","inspection_heading_text_posting":"KonfirmasiuntukMengirimkanIklandenganlaporaninspeksi","inspection_step_1":"KlikKonfirmasiuntukmemasukkanharga","inspection_step_2":"MasukkanLokasi","inspection_step_3":"Postingiklanuntukmengamankanpenawarandaripembeli","price_recommendation_heading":"HargayangdirekomendasikanOLX","powered_by":"dipersembahkanoleh","deal_chances":"peluanguntukmenyelesaikantransaksi","best_price":"HARGATERBAIK","default_price_tooltip":"Untukbantuanpenetapanharga,isikolomwajib(ditandaidengan*)","insurance_type":"JenisAsuransi","insurance_validity":"ValiditasAsuransi","insurance_type_1":"Menyeluruh","insurance_type_2":"Pihakketiga","insurance_type_3":"DepresiasiNol","insurance_type_4":"Berakhir","insurance_submitted":"Selamat!IklanAndaakansegeraditayangkandengandetailasuransi","insurance_heading":"Detailasuransimobil","insurance_validity_date":"Tanggalkeabsahanasuransi","se_details":"Simpandetail","insurance_add_heading_myads_noData":"Tambahkandetailasuransimobil","insurance_add_heading_myads_data":"Editdetailasuransimobil","insurance_add_heading_preview":"Perbaruidetailasuransimobil","insurance_add_subheading_edit":"IklanAndaditayangkandengandetailasuransimobil.Editdetailnyadisini","insurance_add_subheading_myads_noData":"Pembelimemintadetailasuransimobiluntukmenyelesaikankesepakatan","insurance_add_subheading_myads_data":"IklanAndaditayangkandengandetailasuransimobil","insurance_add_subheading_add_edit":"Pembelimemintadetailasuransimobiluntukmenyelesaikankesepakatan.Tambahkanataueditdetaildisini","insurance_add_subheading":"{percente}%pembelimemintaasuransimobiluntukmencapaikesepakatandiOLX.","add_insurance_details":"Tambahkandetailasuransi","edit_insurance_details":"Editdetailasuransi","date_error":"Harapmasukkanformattanggalyangvalid.Harapeditkolom.","searchLocationstooltip":"Seretpetauntukmemilihlokasiyangtepat","searchLocationstooltipMap":"InfokanlokasiAndauntukpemeriksaanMobilsecaraGRATIS","pastSearchesText":"PencarianSebelumnya","use_gmaps_location":"Peta","use_current_location":"Lokasisaatini","current_gps_location_label":"LokasiAnda","fetchingLocationLabel":"MengambilLokasi","enableLocationLabel":"AktifkanLokasi","gpsBlockedLabel":"Lokasidiblokir.Periksapengaturanbrowser\u002Fponsel.","useCurrentLocationLabel":"Gunakanlokasisaatini","select_manually":"Daftar","state":"Wilayah","city":"Kota","locality":"Kecamatan","exitModalMsg":"Andayakininginkeluar?InformasiiklanAndatidakakandisimpan","cover":"Sampul","sell":"Jual","pictureWeightOverflow":"Fototerlalubesar.Silakancobalidenganfotoyangukurannyalebihkecildari{weight}.","call":"Telepon","send_complaint":"Kirimkeluhan","understood":"Oke","knowMore":"KetahuiLebihBanyak","understoodConfirmation":"Mengerti","rcImeContent":"PeriksabianyangdisorotpadadokumenSTNK\u002FBPKBAnda.","locationModalPermissionText":"AktifkanlokasiAndauntukmelihatpenawaranterbaikdidekatAnda:","notificationModalPermissionTitle":"Janganlewatkanpembaruanapapun","notificationModalPermissionBody":"AktifkannotifikasidibrowserAndauntukmenerimachatdaripembelidanpembaruanpadaiklanAnda","notificationModalPermissionCTA":"Oke","knowYourLocation":"Temukaniklanterdekat","editAd":"Edit","deleteAd":"Hapus","removeAd":"Hapus","markAsSold":"Tandaisebaiterjual","deactivate":"Nonaktifkan","whomYouSold":"SiapayangmembeliIklanAnda?","someoneFromOutside":"Seseorangdiluar{brand}","error":"Kesalahan","defaultError":"Telahterjadikesalahan","makeAnOffer":"Buatpenawaran","offerPrice":"BerapakahhargapenawaranAnda?","price":"Tentukanharga","fieldNumeric":"Haraphanyamenggunakanangkapositif","filter":"Filter","imeOf":"Gambar","hot":"Populer","new":"Baru","rejected":"Ditolak","rejected_hard_helper":"IklanAndatidakdapatditerbitkanpada{brand}","rejected_soft_helper":"IklanAndaharusdiubaharditerbitkanpada{brand}","deleted":"Dihapus","pending":"Dimoderasi","pending_info":"IklanAndasedangmenungguuntukditayangkan","disabled_info":"IklanAndadinonaktifkandaridaftariklanAnda","sold":"Terjual","sold_helper":"ItemAndatelahditandaisebaiterjual.Apakahrasanyamenyenangkan?Pasangiklanyangbarusekarang!","outdated":"berakhir","searchHint":"TemukanMobil,Handphone,danlainnya...","resultAutocomplete":"Dalam{category}","searchLocationHint":"Carikota,area,ataulokalitas","submitLocation":"Gunakanlokasiini","home":"Beranda","reportUserModalTitle":"Laporkanpengguna","reportUserModalTitleMX":"Untukmelaporkanpenggunaini,tulispesankekamidi","reportUserEmailSubject":"Laporkanpengguna{user.id}","reportUserEmailBody":"Halo!\n\nSayainginmelaporkanpengguna{user.id}karena_______\n\nBerikutdetailkontaksaya\n\n\n\n\nNama:\n\nTeleponkontak:\n\nEmail:","comment":"Masuk-\u003EMasukkePengguna\u002FSosial-\u003ELayarPersetujuan","description":"Deskripsi","description-1":"InfoDasar","description-2":"TentangbarangAnda","inbox":"Kotakmasuk","noChatsText":"Belumadapesan?","noChatsFooter":"KamiakanmenyimpanpercakapanuntuksetiapbarangyangAndajualdisini","noChatsFooterBuying":"KamiakanmenyimpanpercakapanuntuksetiapbarangyangAndacobabelidisini","confirmationModal":"Konfirmasi","removeAdModalDesc":"AndaakanmenghapusiklanAnda.Andatidakakandapatmembatalkannya.","noResultsPeTitle":"Ups...kamitidakmenemukanapapunyangcocokdenganpencarianini:(","noResultsPeText":"Cobacarisesuatuyanglebihumum,ubahfilter,ataucekkesalahanejaan","seeAll":"Lihatsemua","changeLocationModalTitle":"UbahLokasi?","changeLocationModalDescription":"AndasebelumnyatelahmenerapkanfiturberbayaruntukiklanAnda.KetahuilahbahwajikaAndamengubahkota,fiturituakandihapus.\nApakahAndainginmelanjutkan?","review_profile_details":"Cekkembalidetailinformasi","verify_your_account":"MariverifikasiakunAnda","confirmation_code_sms":"KamiakanmengirimkankodekonfirmasikepadaAndamelaluismspadalangkahberikutnya.","show_phone_number":"Tampilkannomortelepondiiklan","voiceMesse":"PesanSuara","noConversation":"SemuachatAndaakanmunculdisini","makeOfferMsg":"Sayainginmembeliiniuntuk","typingStatus":"mengetik...","onlineStatus":"Online","metaDescriptionForCarsCategoryListing":"Temukan{category}terbaikyangdijualdi{country}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","metaDescriptionForCarsLocationCategoryListing":"Temukan{category}terbaikyangakandijualdi{localization}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","metaDescriptionForCarsMakeLocationCategoryListing":"Temukan{make}{category}terbaikyangdijualdi{localization}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","metaDescriptionForCarsMakeModelLocationCategoryListing":"Temukan{make}{model}{category}yangdijualdi{localization}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","metaDescriptionForCarsMakeCategoryListing":"Temukan{make}{category}yangdijualdi{country}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","metaDescriptionForCarsMakeModelCategoryListing":"Temukan{make}{model}{category}yangdijualdi{country}.{brand}memilikipilihanteratasuntukmobilbarudanbekasyangdijual.DapatkanmilikAndahariini!","listingTitle":"{brand}-BelidanJualgratisdimanapundi{country}denganIklanBarisonline{brand}","listingDescription":"{brand}memiliki1000iklanyangtersediadi{country}daribarangyangdijualmulaimobil,furnitur,elektroniksampaidaftarpekerjaandanlayanan.Beliataujualsesuatuhariini!","listingTitleLocation":"Iklanbarisdidekat{location}|{brand}{country}","listingDescriptionLocation":"Semuaiklanbarisdi{location}.{brand}{country},temukansekarangsemuaiklanbarisdi{location}","listingTitleCategory":"Iklanbarisdalam{category}|{brand}{country}","listingDescriptionCategory":"Semuaiklanbarisdari{category}di{country}menantiAnda.{brand}{country},temukansekarangsemuaiklanbaris{category}.","listingTitleCategoryLocation":"Iklanbarisdalam{category}di{location}|{brand}{country}","listingDescriptionCategoryLocation":"Semuaiklanbarisdalam{category}di{location}.{brand}{country},temukansekarangsemuaiklanbaris{category}di{location}.","listingTitleQuery":"{querySearch}di{country}|{brand}{country}","listingDescriptionQuery":"Temukan{querySearch}untukdijual.{brand}{country},temukansekarangsemuaiklanbaris{querySearch}.","listingTitleQueryCategory":"{querySearch}di{category}|{brand}{country}","listingDescriptionQueryCategory":"Temukan{querySearch}di{category}.{brand}{country},temukansekarangsemua{querySearch}dalamiklanbaris{category}.","listingTitleQueryLocation":"{querySearch}di{location}|{brand}{country}","listingDescriptionQueryLocation":"Temukan{querySearch}di{location}.{brand}{country},temukansekarangsemuaiklanbaris{querySearch}di{location}.","listingTitleQueryCategoryLocation":"{querySearch}dalam{category}di{location}|{brand}{country}","listingDescriptionQueryCategoryLocation":"Temukan{querySearch}dalam{category}di{location}.{brand}{country},temukansekarangsemua{querySearch}dalamiklanbaris{category}di{location}.","titleForCarsCategoryListing":"{category}dijualdi{country}|{brand}","titleForCarsLocationCategoryListing":"{category}dijualdi{localization}|{brand}","titleForCarsMakeLocationCategoryListing":"{make}dijualdi{localization}|{category}di{brand}","titleForCarsMakeModelLocationCategoryListing":"{make}{model}dijualdi{localization}|{category}di{brand}","titleForCarsMakeCategoryListing":"{make}dijualdi{country}|{category}di{brand}","titleForCarsMakeModelCategoryListing":"{make}{model}dijualdi{country}|{category}di{brand}","imeLimitSize":"GambaryangAndacobaunggahterlalubesaratauterlalukecil","retry":"Cobali","noSelectedChat":"Pilihchatuntukmelihatpercakapan","fieldPhone":"Nomorteleponsalah","lastSeen":"Terakhirdilihatpada{date}pukul{time}","imeMsg":"Gambar","LocationMsg":"Lokasi","shareLoc":"Bikanlokasi","selectLoc":"PilihLokasi","chatHeader":"Chat","appliedFilterAtLeast":"Setidaknya{min}","appliedFilterUpTo":"Hingga{max}","appliedFilterBetween":"Antara{min}sampai{max}","connectionLost":"Tidakdapatmengirimpesan.Harapsegarkan.","mandatoryField":"Wajibdiisi","invalidEmail":"Emailtidakvalid","chatConnecting":"Menghubungkandalam{timer}s","connectingInfo":"Menghubungkan...","offline":"Offline","allCategories":"SemuaKategori","today":"Hariini","yesterday":"Kemarin","didYouMean":"ApakahmaksudAnda","adsInLocation":"Iklandi{name}","categoryInLocation":"{category}dalam{location}","suggestedCategories":"SaranKategori","noAdsInLocation":"Saatinitidakadaiklandi{selectedLocation}untukpilihanAnda","adsInParentLocation":"KamitelahmemilihkanbarangserupainiuntukAndapada{parentLocation}","listing_ad_featured_label":"Highlight","listing_ad_preview_label":"Pratinjau","listing_ad_autoboostad_label":"AutoSundul","limited":"TidakDipasang","disabled":"Nonaktif","featureAdButton":"JualLebihCepat","featureAdCreditsGetStartedButton":"Oke","featureAdConfirmPurchaseCreditsCost":"Kredit","boostAdTouchpointText":"Jangkaulebihbanyakpembelidanjuallebihcepat","boostAdSuccessfulTitle":"Selamat!","boostReachMoreBuyers":"Jangkaulebihbanyakpembelidanjuallebihcepat","boostUpgradePosition":"TingkatkanIklanAndakeposisiteratas","boostPreviewAd":"LihatKembaliIklanAnda","boostChoosePacke":"Pilihpaketarlebihcepatterjual","boostAdSuccess":"IklanAndaberhasildihighlight","boostBttAdSuccess":"FituriklanAndaakansegeraditayangkan","autoboostAdSuccess":"IklanAndaakandisundulsegeradanakanterusdisundulsetiap{autoBoostAdFrequency}hari","boostProposition1":"TampilkanIklanAndadiposisiteratas","boostProposition2":"DapatkanperhatiandengantiklanHighlight","boostPackeAppy":"Simpan","buyBusinessPackes":"BeliPaketBisnis","showBusinessPackes":"TampilkanPaket","businessLandingPeLabel":"PILIHOPSIUNTUKMENAMPILKANPAKET","selectcategory":"PilihKategori","selectsubcategory":"PilihSubkategori","businessLandingEnterLocation":"MasukkanLokasi","limitsailable":"Tersedia:","limitsAds":"iklan","limitsAd":"iklan","limitsUnlimited":"TakTerbatas","limitsExpires":"Paketberakhirpada","limitsFreeAdsUsedInCategory":"IklanAndatidakdipasang","limitsChoosePacke":"PilihpaketuntukmemasangIklan","limitsTotalFreeAds":"{brand}mengizinkan{totalFreeAds}iklangratisdalam{freeLimitDays}hari","limitsTotalFreeAdsPlural":"{brand}mengizinkan{totalFreeAds}iklangratisdalam{freeLimitDays}hari","limitsUnlimitedPackeUsed":"AndatelahmenggunakanIklandari","limitsPackeLeftAds":"sisafituriklandi","limitsPackeLeftAd":"sisafituriklandi","limitsUserPackeBefore":"Sisawaktupenggunaanpaketadalah","limitsAllAdsConsumedFeature":"telahberhasildigunakan","limitsAllAdsConsumedBTT":"telahberhasildigunakan","limitsAllAdsConsumedLimit":"telahberhasildigunakanuntukmemasangIklan","limitsAdVisibleAfter":"IklanAndaakansegeraditayangkan.","limitsAddGSTDetails":"TambahkanInformasiTihan","limitsPurchePacke":"Bayar{amount}","limitBusinessPkgLabel":"DiskonbesaruntukPaketBisnis","limitBusinessMultiPkgLabel":"DiskonbesaruntukPaketBisnis","limitBusinessPkg":"LihatPaket","limitsPostAd":"PasangIklan","ordersMy":"PaketyangDibeli","ordersActive":"Aktif","ordersScheduled":"Terjadwal","ordersExpired":"Berakhir","ordersPacke":"Paket","ordersDateOfActivation":"TanggalAktivasi","ordersDateOfExpiry":"TanggalBerakhir","ordersId":"IDPesanan","ordersPurchased":"Dibeli","ordersailable":"Tersedia","ordersUsed":"Digunakan","ordersRepeatPurchase":"BeliLi","ordersNoActivePackes":"Andatidakmemilikipaketaktifapapun","ordersNoScheduledPackes":"Andatidakmemilikipaketterjadwalapapun","ordersNoExpiredPackes":"Andatidakmemilikipaketkedaluwarsaapapun","buyPkgWhatNext":"Apayangharusdilakukanselanjutnya?","buyPkgAdPostedProposition":"Andatelahmemasang{totalFreeCount}iklangratisdalam{freeLimitDuration}hariterakhiruntukkategori{categoryName}","buyPkgAdPostedPropositionPlural":"Andatelahmemasang{totalFreeCount}iklangratisdalam{freeLimitDuration}hariterakhiruntukkategori{categoryName}","buyPkgAllAdProposition":"Semuaiklanberbayardi","buyPkgCategory":"Kategori","buyPkgWaitForDays":"Tunggu{nextFreeAdDays}hariberikutnyauntukmemasangIklanini","buyPkgFeatureAdT":"Dapatkanpemberitahuandengant'HIGHLIGHT'diposisiteratas","buyPkgBundleFeatureAdT":"Pasanglebihbanyakiklan&lebihmudahdilihatdenganlogo\"HIGHLIGHT\"diposisiatas","buyPkgFeatureAdHighlight":"Iklanakandihighlightkeposisiatas","buyPkgBttProposition":"Kembalikeatassepertiiklanbaru","buyPkgAutobttProposition":"Semuaiklandalamkategoriakandisundulkeatassetiapbeberapahari","buyPkgBundleLimitAutobttProposition":"Pasanglebihbanyakiklan&disundulkeatassetiapbeberapahari","buyPkgValidity":"Validitaspaket{validity}hari","buyPkgailability":"Pakettersediaselama{validity}hari","buyPkgLocationApplicable":"Berlakuuntukkategori{categoryName}di{location}","buyPkgLocationApplicableCountry":"Berlakuuntukkategori{categoryName}diseluruh{location}","buyPkg_LIMITS":"Pasanglebihbanyakiklan","buyPkg_FA":"IklanHighlight","buyPkg_BTT":"Sundul","buyPkg_AUTOBOOST":"Otomatissundul","buyPkg_LIMITS_FA":"Pasanglebihbanyakiklan&fitur","buyPkg_LIMITS_AUTOBOOST":"Pasanglebihbanyakiklan&AutoSundul","buyPkgSeeExample":"Lihatcontoh","buyPkgSeeExampleFaProposition":"Iklanmunculdenganthighlightdiposisiteratas","buyPkgSeeExampleBttProposition":"Kembalikeatassepertiiklanbaru","buyPkgViewCart":"LihatKeranjang","buyPkgViewCartItems":"{totalItems}Item","buyPkgViewCartItem":"{totalItems}Item","buyPkgViewCartTotal":"total{totalAmount}","buyPkgProductTypeForDays_LIMITS":"Pasanglebihbanyakiklan","buyPkgProductTypeForDays_FA":"Iklanyangdihighlightselama{validity}hari","buyPkgProductTypeForDays_LIMITS_FA":"PasangIklan&Highlightuntuk{validity}hari","buyPkgProductTypeForDays_BTT":"Sundul","buyPkgProductTypeForDays_AUTOBOOST":"Tingkatkanotomatiskeatassetelahsetiap{validity}hari","buyPkgProductTypeForDays_LIMITS_AUTOBOOST":"PasangIklan&AutoSundulsetiap{validity}hari","buyPkgMultipleSuccess":"Paketberhasildibeli","buyPkgMultipleNoPkgs":"Pakettidakditemukan","buyPkgChoosePacke":"Pilihpaket","buyPkgGotoMyAds":"BukaIklanSaya","buyPkgSingleSuccess":"Paket{packeName}berhasildibeli","buyPkgAllAds":"SemuaIklan","limitsFeaturedAdVisibleAfter":"IklanAndaakanterpasangsebentarlidanotomatisterhighlightuntuk{duration}hari","limitsAutoboostAdVisibleAfter":"IklanAndaakanterpasangsebentarlidandisundulsecaraotomatiskeatassetiap{autoBTTFrequency}hari","pkgViewCartApplicableLable":"Paketberlakuuntuk{categoryName}di{location}","pkgCartHeaderLabel":"LihatKeranjang","pkgCartPriceLabel":"DETAILHARGA","priceLabel":"Harga","discountLabel":"Diskon","totalLabel":"Total","myAds":"Iklan","myAdsFrom":"Dari:","myAdsTo":"Ke:","error_title":"Adayangtidakberes","error_subtitle":"Kamimengalamikesulitan,harapcobali.","gothere":"KESANA","forbiddenAction":"TindakanTerlarang.","b2cUsersForbiddenAction":"SilakangunakanwebatauaplikasiOLXBusiness.","myAdsLimitsButton":"PasangIklanSekarang","myAdsLimitsWaitTextOnePlural":"Tunggu{days}hariuntukmemasangiklansecaragratisataubayaruntukmemasangiklansekarang","myAdsLimitsWaitTextOtherPlural":"Tunggu{days}hariuntukmemasangiklansecaragratisataubayaruntukmemasangiklansekarang","myAdsLimitZeroConfigLimit":"Semuaiklandibayardalamkategori{categoryName}.Bayaruntukmempostingsekarang.","myAdsLimitsPostNowText":"Andasekarangdapatmemasangiklanini","myAdsBoostedToday":"Iklandisundulhariinipada{time}","myAdsBoostedYesterday":"Iklandisundulkemarinpada{time}","myAdsBoosted":"Iklandisundulpada{date}jam{time}","my_ads_mark_as_sold_question_text":"ApakahAndamenjualIklanAnda?","my_ads_pending_text":"Iklaninisedangdiprosesdanakansegeraditayangkan","my_ads_active_text":"Iklaninisaatiniditayangkan","my_ads_sold_text":"Iklaninidijual","my_ads_expired_text":"Iklaninitelahkedaluwarsa.JikaAndamenjualnya,silakantandaisebaisudahterjual","my_ads_edit_now_text":"EditSekarang","my_ads_deactivate_text":"PerhatikanbahwaAndamungkinharusmembayaruntukmemasangiklanli","my_ads_deactivate_title":"NonaktifkaniklanAnda","my_ads_disabled_text":"Iklaninitelahdinonaktifkan.","myAdsAdViews":"Dilihat","myAdsAdLikes":"Disukai","myAdsAdCalls":"Dihubungi","my_ads_moderation_hard_text":"IklaninitidakdipublikasikankarenatidaksesuaidengansyaratpemasanganiklandiOLX.","my_ads_moderation_soft_text":"Iklaninitidakdipublikasikan.Editdanlakukanpenayangan.","my_ads_moderation_button_text":"Pelajarilebihlanjut","my_ads_moderation_popup_title_text":"Iklaninitidakdipublikasikan","my_ads_moderation_popup_hello_text":"Halo{user},","my_ads_moderation_popup_subtitle":"KamimenyesalmemberitahuAndabahwaiklanAndadapatditolakkarenaalasanberikutyangtercantumdibawahini:","my_ads_moderation_popup_rule1":"KontenyangAndajualdilarang","my_ads_moderation_popup_rule2":"Judulataudeskripsitidakpantas","my_ads_moderation_popup_rule3":"Fototidakjelasatautidakmenyenangkan","my_ads_moderation_popup_rule4":"Hargayangditetapkanterlalutinggiatauterlalurendah","my_ads_moderation_popup_rule5":"Iklaninidianggapsebaiduplikat","my_ads_moderation_popup_posting_guidelines_link":"UntukmengetahuiselengkapnyatentangalasaniklanAndaditolakdandipasangli,harapbacaperaturankamidibawah{postingGuidelines}.","my_ads_moderation_popup_posting_guidelines_text":"pedomanpemasanganiklan","my_ads_moderation_popup_firm":"Tim{brand}.","my_ads_moderation_popup_edit_button":"Editiklan","my_ads_moderation_popup_delete_button":"Hapusiklan","my_ads_search_box_help_text":"CariberdasarkanJudulIklan","my_ads_search_box_maxchars_validation_text":"Harusberisisetidaknya3karakter.","my_ads_filters_by":"FilterBerdasarkan:","my_ads_view_all":"LihatSemua","downloadLeads":"UnduhProspek","downloadLeadsHeading":"MenyiapkanUnduhan","requestInProcessStatusText":"Sedangberlangsung...","requestWarningStatusText":"Tidakadaprospek","requestFailedStatusText":"gal","preparingLeadsToast":"Menyiapkanprospek...","preparationWarningTitle":"UnduhanSedangBerlangsung","failedRequestModalTitle":"UnduhanProspekGal","failedRequestModalText":"PeriksajaringanAndadancobali.","abortLeadDownloadConfirmation":"Andainginmembatalkanpersiapanprospek?","requestTimeoutText":"WaktuPermintaanHabis","defaultFailedText":"PermintaanGal","downloadLeadButtonText":"UnduhProspek","downloadLeadProgressStart":"Prospekunduhansedangdalamprosesuntuk","downloadLeadProgressDays":"lewat{daysToDownload}hari.","downloadLeadProgressEnd":"Haraptunggu.","downloadLeadsFileName":"ProspekyangDikonsolidasi{timeStamp}","creditsHistoryEmptyStateTitle":"Halamankosong...","featureAdPackeExpiredDurationOnePlural":"{featureAdRemainingDays}hari","featureAdPackeExpiredDurationOtherPlural":"{featureAdRemainingDays}hari","featureAdPackeExpiredDurationOnePluralHours":"{featureAdRemainingDays}jam","featureAdPackeExpiredDurationOtherPluralHours":"{featureAdRemainingDays}jam","featureAdPackeExpiredDurationOnePluralMinutes":"{featureAdRemainingDays}menit","featureAdPackeExpiredDurationOtherPluralMinutes":"{featureAdRemainingDays}menit","featureAdPackeTimeRemaining":"tersisa","billing_section_title":"Tihan","billing_access_to_invoices_button_title":"Faktur","billing_access_to_invoices_button_description":"UnduhfakturAnda","billing_access_to_invoices_invoice_label":"Faktur","billing_access_to_invoices_credit_note_label":"CatatanKredit","billing_access_to_details_title":"Informasitihan","billing_invoices_section_empty_state_title":"Andatidakmemilikifaktur","billing_invoices_section_empty_state_description":"ApakahAndabelummencobaiklanHighlightkami?TingkatkantayanganAnda!","billing_business_user_confirmation_title":"SetelahdetailbisnisAndadisimpan,Andatidakdapatmengubahkembalimenjadipelangganresidensial.ApakahAndainginmelanjutkan?","profile_cta_verify_gst":"VerifikasiGSTIN","loadingAdsToRelocate":"Memuatiklan...","_comment_":"BuatDoronganPenawaran","olxRecommendedOffers":"PenawaranyangdirekomendasikanOLX","poweredBy":"dipersembahkanoleh","offerCategoryNudge":"{value}diterima!","respondQuickly":"Tanggapidengancepat","completeKycText":"SelesaikanKYCAnda","kycLimitBreachDesc":"AndatelahmencapaibatasAndauntukmenghubungipenjualtanpaverifikasi.SelesaikankycAndadiaplikasiandroiduntukmelanjutkan.","kycCountLeftDesc":"Andahanyadapatmenghubungi{kycCountLeft}penjualli,selesaikankycAndadenganmasukkeaplikasiandroid.","chatLimitOver":"Batasobrolanberakhir","sellerKycCountLeftDesc":"Hanya{kycCountLeft}*pembeliliyangdapatmenghubungiAndahariini.LengkapiKYCAndamelaluiaplikasiandroiduntukberbicaradenganlebihbanyakpembeli.","sellerCaption":"*Termasukobrolanyangdihapus&tidakaktif","lowOfferNudgeToast":"Andamencobamembuatpenawaranrendah,buatpenawaranyanglebihbaiksaja","offerTemplateNudgeToast":"Kirimpenawarandarisiniarkemungkinanditanggapipenjualtinggi","chatToKnowMore":"Mengobrolartahulebihbanyak!","chatToKnowMoreDesc":"Selesaikantransaksidengancepat,denganbertanyalebihlanjuttentangprodukatauindividunya.","blockUserDialog":"Blokir{user}?PenggunayangdiblokirtidakdapatmengirimpesankeAnda","unblockUserDialog":"Bukablokir{user}untukmengirimpesan.","blockSuccessMsg":"Penggunaberhasildiblokir!","unblockSuccessMsg":"Penggunaberhasildibukablokirnya!","blockErrorMsg":"Tidakdapatmembukablokirpengguna.Silakancobali!","unblockErrorMsg":"Tidakdapatmembukablokirpengguna.Silakancobali!","shareConatctWarningList1":"IdentitasPalsu","shareConatctWarningList2":"Penipu","shareConatctWarningList3":"PenipuankodeQR","shareConatctWarningList4":"PenipuanUPI","shareConatctWarningTips":"KetahuiLebihBanyak","paymentErrorServerError":"Kesalahanserverinternal.Silakancobalinanti.","bucket-size":"{bucketSize}kmdari{location}","nation-wide":"Terbarudalam{location}","all-country":"Semuanegara","slider-bucket-size":"{bucketSize}km","login_method_selection_fb_button":"Login\u002FDaftardenganFacebook","login_method_selection_google_button":"Login\u002FDaftardenganGoogle","login_method_selection_sms_button":"Login\u002FDaftardenganTelepon","login_method_selection_email_button":"Login\u002FDaftardenganEmail","login_method_selection_email_button_no_registration":"MasukdenganEmail","login_method_selection_tandc_text":"JikaAndalogin,Andamenerima","login_method_selection_tandc_link":"SyaratdanKetentuansertaKebijakanPrivasi{brand}","login_method_tnc":"SyaratdanKetentuan{brand}","login_method_tnc_tr":"SayamenyetujuiSyaratdanKetentuan","login_method_selection_tandc_tr_text":"Denganmelanjutkan","login_privacy_policy":"KebijakanPrivasi","login_method_selection_value_proposal_text":"Akunterverifikasimembantumenjadikan{brand}sebaitempatyanglebihaman.Jangankhawatir,kamitidakakanmembikandetailpribadiAndadengansiapapun.","loginSafetyTitle":"Bantujadikan{brand}tempatjualbeliyanglebihaman","loginPrivacyDesc1":"KamitidakakanmembikandetailpribadiAndadengansiapapun","loginDealsTitle":"HubungidanDeallebihcepat","loginForitesTitle":"SimpansemuabarangforitAndadisatutempat","login_sms_welcome_msg":"Selamatdatangdiolx","login_sms_account_is_banned":"Akundiblokir","login_sms_enter_phone_title":"MasukkannomorteleponAnda","login_sms_enter_phone_messe":"KamiakanmengirimkankodekonfirmasikenomorAnda","login_sms_enter_phone_country":"Negara","login_sms_enter_phone_number":"MasukkannomorHP","login_sms_enter_number":"Masukkannomor","login_sms_enter_email_contact":"MasukkanEmail","login_sms_enter_code_register_messe":"Kamimengirimkode4digitke{phone}","login_sms_create_password_button":"Buatkatasandi","login_create_new_password":"Buatkatasandibaru","login_sms_create_password_title":"Buatkatasandiuntukloginlebihcepatpadalainwaktu","login_resend_code_sms":"KirimulangkodemelaluiSMS","login_resend_code_call":"Kirimulangkodemelaluipanggilantelepon","login_sms_auto_detect_trying":"Kamisedangmencobamendeteksikode","login_sms_auto_detect_fail":"Kamitidakdapatmendeteksikode","login_sms_auto_detect_success":"Kamitelahberhasilmendeteksikodetersebut","login_email_enter_email_title":"MasukkanEmailAnda","login_email_enter_email_login":"MasukkanemailAndauntukmasuk","login_email_enter_email_email":"Email","login_email_update_email":"Perbaruiemail","login_email_contact_information":"KamiakanmenggunakaninformasiiniuntukmengabariAndatentangtransaksiAndadiOLXAutos","login_email_create_password_messe":"Andamembuatkatasandiuntuk{email}.IniakanmembantuAndaloginlebihcepatdilainwaktu.","login_email_enter_password_title":"MasukkankatasandiAnda","login_email_enter_password_messe":"Selamatdatangkembali{email}","login_email_enter_phone_privacy":"KamitidakakanmengungkapkanemailAndakepadaoranglainataumenggunakannyauntukmengirimiAndaspam","login_enter_phone_privacy":"KamitidakakanmengungkapkannomorteleponAndakepadaoranglainataumenggunakannyauntukmengirimspam","login_email_enter_messe":"KamiakanmengirimkankodekonfirmasikeemailAnda","login_email_select_other_login_option_messe":"JikaAndaadalahpenggunabaru,silakanpilihopsimasuklainnyadarihalamansebelumnya.","login_email_not_registered":"Emailtidakterdaftar","login_email_not_registered_text":"HarapberikanalamatemailyangbenardanterdaftardenganOLX.JikaAndaadalahpenggunabaru,Andadapatmendaftarmenggunakanopsilaindenganmengkliktombol'Daftar'.","login_email_enter_password_dont_match_messe":"Katasanditidakcocok.","login_email_enter_password_forgot_messe":"LupakatasandiAnda?","login_email_reset_password_title":"AturulangkatasandiAnda","login_email_reset_passwrod_messe":"Andamengaturulangkatasandiuntuk{email}","login_go_to_login_pe":"Kembalikehalamanmasuk","login_next_button":"Lanjut","login_login_button":"Login","login_register_button":"Daftar","login_resend_code_button":"Mintakodebaru","login_email_enter_password_confirm":"KonfirmasiKataSandi","login_resend_try_ain_messe":"(Cobalidalam{time})","login_enter_confirmation_code_title":"Masukkankodeyangditerima","login_enter_confirmation_code_text":"Kamimengirimkode4digitke{value}","login_create_password_instructions":"Gunakanminimal6karakter,dansetidaknyasatuhurufdansatuangka","writeMesseTo":"Tulispesanke{user}","writeMesseHere":"TuliskanpesanAndadisini","sendMesse":"Kirimpesan","wantsToKnow":"Hai!{user}ingintahusiapaAnda","messeSent":"PesanAndaberhsaildikirim.","login_invalid_phone":"Harapmasukkannomorteleponyangvalid","login_auto_adblock_error":"Harapnonaktifkanpemblokiriklan(ad-blocker)Andauntuklogin","login_auto_logout_error":"Andaperlulogoutdariakunsebelumnyaardapatmenggunakanloginotomatis","account_phone_verification_title":"MasukkannomorteleponAndauntukmemverifikasiakunAnda","account_email_verification_title":"MasukkanemailAndauntukmemverifikasiakunAnda","account_phone_verification_post_text":"NomorteleponyangAndaberikandisinihanyadigunakanuntukmemverifikasiakunAnda.Nomorinitidakakandipublikasikan.","account_email_verification_post_text":"EmailyangAndaberikandisinihanyadigunakanuntukmemverifikasiakunAnda.Nomorinitidakakandipublikasikan.","ad_expiration_item_detail_expiration_date":"IklanAndaberakhirpada{expirationDate}","ad_expiration_republish_button":"Terbitkanulang","ad_expiration_not_ailable_title":"Mohonmaaf,iklaninitidaktersediali","ad_expiration_not_ailable_subtitle":"Tapijangankhawatir,kamitelahmemilihkaniklanserupainiuntukAndadi:","ad_expiration_republish_too_old":"IklanAndaterlalulamauntukditerbitkanulang","ad_expiration_is_expired_soft":"IklanAndatelahkedaluwarsa.Terbitkanulangsekarang!","sort_by":"SortirMenurut","searchByMake":"Cariberdasarkantahunpembuatan","searchByModel":"Cariberdasarkanmodel","searchByVariant":"Cariberdasarkanvarian","allMakesAndModels":"SemuaMerekdanModel","allMakes":"SemuaMerek","allModels":"SemuaModel","allVariants":"SemuaVarian","selectMake":"PilihTahunPembuatan","selectModel":"PilihModel","selectVariant":"PilihVarian","to":"sampai","report_error_no_reason":"Harappilihalasanlaporan","report_error_no_comment":"Haraptambahkankomentaruntukmembantukamimemahamiapayangtidakberesdenganbarangini.","report_profile_title":"Laporanpengguna","report_profile_reason_1":"Gambarprofilyangtidakpantas","report_profile_reason_2":"Penggunainimengancamsaya","report_profile_reason_3":"Penggunainimenghinasaya","report_profile_reason_4":"Spam","report_profile_reason_5":"Penipuan","report_profile_reason_6":"Lainnya","report_profile_reason_7":"Pelecehanseksual","report_ad_title":"Laporanbarang","report_ad_reason_1":"Kontenmenyinggung","report_ad_reason_2":"Penipuan","report_ad_reason_3":"Iklanganda","report_ad_reason_4":"Produksudahterjual","report_ad_reason_5":"Lainnya","report_sent_messe":"Kamiakanmengurusinisesegeramungkin.","clearAll":"Hapussemua","radioButtonNo":"Tidak","viewAll":"LihatSemua","viewMore":"Lihatlainnya","viewLess":"Lihatlebihsedikit","radioButtonYes":"Ya","orBrowseCategories":"AtauAndadapatmenelusuridalamkategorikami...","oops":"Ups!","cantFind":"Kamitidakdapatmenemukannya.","trySearch":"Cobacari.","error404":"Kesalahan404","helpfulLinks":"Berikutinibeberapatautanyangbermanfaat:","popularSearches":"PencarianPopuler","recentSearches":"Pencarianterbaru","regions":"Daerah","mostPopularCitiesInWholeCountry":"KotaTerpopulerdiSeluruhNegara","categoryBrowsingSubtitle":"Telusuribeberapakategoripalingpopulerkami.","locationBrowsingSubtitle":"Telusuribeberapalokasiterpopulerkami.","nearbyAds":"IklanTerdekat","moreOptions":"OpsiLainnya","search":"Cari","allResults":"Semuahasil","allStatesIn":"Semuawilayahdi{locationName}","allCitiesIn":"Semuakotadi{locationName}","allNeighborhoodsIn":"Semualingkungandi{locationName}","moreNeighborhoodsIn":"Lingkunganlainnyadi{locationName}","reportAd":"LAPORKANIKLANINI","reportAdNew":"UntukmelaporkanIklanini,kirimpesanke","adID":"IDIKLAN","placeholderTitle":"InginmelihatbarangAndadisini?","placeholderBody":"Hasilkanuangtambahansekarangdenganmenjualbarang-barangdikomunitasAnda.AyomulaiberjualandiOLX,semuajadicepatdanmudah.","placeholderCTA":"PasangIklan","searchLocationsPlaceholderText":"Carikota,area,ataulokalitas","tipsForGmapsLocation":"MemilihlokasiakuratAndamembantupembeliterdekatmelihatnya,danmeningkatkanpeluangpenjualanAndalebihcepat.","sort":"Sortir","view":"TipeTampilan","noService":"OLXbelumadadiwilayahyangdipilih.SilakanubahlokasiAndauntukmelanjutkan.","gpsPermissionDenied":"IzinlokasiAndadiblokir.MohonaktifkanizinlokasiuntukmemilihlokasiAndasaatini.","continueToChat":"LANJUTKANUNTUKCHAT","continueToCall":"LANJUTKANUNTUKMENGHUBUNGI","continueToSms":"LANJUTKANUNTUKSMS","continueToOffer":"LANJUTKANUNTUKMENAWARKAN","ftutHeading":"Tipstransaksiaman","yesButton":"Ya","noButton":"Tidak","logout_all_devices_title":"Keluardarisemuaperangkat","logout_all_devices_list_title":"Keluardarisemuaperangkat","logout_all_devices_confirm":"Andaakandikeluarkandarisemuabrowserdansesiaplikasi.Inginmelanjutkan?","account_suspended_title":"AkunAndatelahditahan","account_suspended_text":"PelajariselengkapnyatentangalasanterjadinyahalinidenganmengunjungiPusatBantuankami.","account_deactivate":"Hapusakundanhapusdata\u002Fiklansaya","account_deactivate_confirm":"ApakahAndayakin?SemuaiklanAndasecaraotomatisakanterhapus","account_deactivate_ok":"Nonaktifkan","account_deactivate_cancel":"Batalkan","account_reactivated_title":"Selamatdatangkembali!","account_reactivated_body":"AkunAndatelahdiaktifkankembali.Andasekarangdapatmulaimenggunakan{brand}li.","noNotificationsTitle":"Tidakadanotifikasi","noNotificationsText":"Cekkembalidisiniuntuknotifikasiterbaru!","showMore":"+tampilkanlainnya","consent_email_title":"Email","consent_email_subtitle":"Sayainginmenerimaemailpemberitahuantentangpromosi","consent_sms_title":"SMS","consent_sms_subtitle":"SayainginmenerimapesanSMStentangpromosi","consent_whatsapp_title":"Whatsapp","consent_whatsapp_subtitle":"SayainginmenerimapesanWhatsapptentangpromosi","consent_phone_title":"Telepon","consent_phone_subtitle":"Sayainginmenerimapanggilantelepontentangpromosi","consent_opt_out_email_title":"Andamenyisihdariemail","consent_opt_out_email_confirm_text":"ApakahAndayakintidakinginmenerimapemberitahuanemailtentangpromosiyangmungkinmenarikbiAnda?","consent_opt_out_sms_title":"AndamenyisihdariSMS","consent_opt_out_sms_confirm_text":"ApakahAndayakintidakinginmenerimapesanSMStentangpromosiyangmungkinmenarikbiAnda?","consent_opt_out_whatsapp_title":"AndamenyisihdariWhatsapp","consent_opt_out_whatsapp_confirm_text":"ApakahAndayakintidakinginmenerimapesanWhatsapptentangpromosiyangmungkinmenarikbiAnda?","consent_opt_out_phone_title":"Andamenyisihdaripanggilantelepon","consent_opt_out_phone_confirm_text":"ApakahAndayakintidakinginmenerimapanggilantelepontentangpromosiyangmungkinmenarikbiAnda?","consent_pe_login_flow_title":"PerlindunganDataPribadidanPesanKomersialElektronik","consent_pe_login_flow_subtitle":"*WajibDiisi","data_privacy_notice":"PemberitahuanPrivasiDataPelanggan","tnc_of_use":"Syaratdanketentuanpenggunaan","acknowledge_read":"Sayatelahmembaca,","customer_explicit_consent":"PersetujuanEksplisitPelanggan","read_and_accept":"Sayamembacadanmenerima","marketing_consent_text":"Sayamemberikanpersetujuanarpesanelektronikkomersial(email,SMS,panggilantelepon,dll.)untukdikirimkepadasaya(termasukkampanye,promosi,pesaniklan,dll.)sesuaidenganUndang-UndangtentangPerdanganElektronik.","my_account_enter":"MasukkeakunAnda","my_account_login":"LoginkeakunAnda","my_account_orders_invoices_billing":"PaketyangDibeli&Penihan","my_account_settings":"Pengaturan","my_account_settings_privacy":"Privasi","my_account_settings_notifications_specialcomms":"Komunikasi&Promosi","my_account_settings_notifications_specialcomms_sub":"Terimapembaruan,penawaran,danlainnya","my_account_settings_notifications_recommendations":"Rekomendasi","my_account_settings_notifications_recommendations_sub":"TerimarekomendasiberdasarkanaktivitasAnda","my_account_settings_notifications":"Notifikasi","my_account_settings_notifications_chat":"Tipskeamananobrolan","my_account_settings_notifications_safety_tips":"TipsKeamanan","my_account_settings_notifications_safety_tips_sub":"TerimatipskeamananberdasarkanaktivitasobrolanAnda","my_account_unlink_confirm_title":"HapusTautanAkun?","my_account_unlink_confirm_modal_title":"HapusTautanAkun?","my_account_unlink_confirm_copy":"Andaakankehilanganakseske{brand}menggunakanakunini,danlogoakandihapusdariprofilAnda.Tindakaninitidakdapatdibatalkan.","my_account_unlink_google_text":"Iniakanmenghapusakun{brand}yangditautkankeakunini?Tindakaninitidakdapatdibatalkan.","my_account_unlink_confirm_ok":"Hapustautan","link_account_INVALID_PHONE_FORMAT":"Formattelepontidakvalid","link_account_invalid_secret":"Kodetidakvalid.Cobaliataumintayangbaru.","my_account_privacy_my_ads_title":"Pengaturaniklansaya","my_account_privacy_phone":"Tampilkannomortelepondiiklan","download_data_title":"KontrolkontenAnda","download_data_subtitle":"UnduhdataAnda","download_data_copy_1":"Andayangmemegangkendaliataskontenakun{brand}Anda,meskiAndatidakmenggunakannyali.","download_data_copy_2":"BuatarsipdengansalinandataAndadi{brand}","download_data_button":"Buatarsip","download_data_in_progress_title":"Arsipsaatinisedangdipersiapkan","download_data_in_progress_copy":"Harapdicatatbahwapembuatanarsipmungkinmembutuhkanwaktuyanglama(jamataumungkinhari).AndaakandiberitahuketikaarsipAndasiapuntukdiunduh.","download_data_file_title":"Arsip{dateCreated}","download_data_file_description":"Berakhir{dateExpires}","download_data_download":"Unduh","terms_title":"Sebelummelanjutkan...","terms_copy":"Denganmengkliktombollanjutkan,sayamenerima{termsOfUse}.SayamengakuibahwaOLXB.V.menggunakandatapribadisayasesuaidengan{privacyStatements}dan{cookiesPolicy}.OLXB.V.menggunakansistemdanmitraotomatisuntukmenganalisisbaimanasayamenggunakanlayananuntukmenyediakanfungsionalitasprodukyangrelevan,konten,iklanberbasisminatdanditargetkan,sertaperlindunganterhadapspam,malware,danpenggunaanyangtidaksah.","terms_accept":"Lanjutkan","terms_deny":"Batalkanlogin","cookies_banner_copy":"Saatmenggunakanlayanankami,Andamengakuibahwakamimenggunakancookiedanteknologiserupauntukmeningkatkandanmenyesuaikankontenkami,menganalisislalulintas,menyediakaniklan,sertaperlindunganterhadapspam,malware,danpenggunaanyangtidaksah.","cookies_banner_accept_button":"Terima","cookies_banner_more_button":"Pelajarilebihlanjut","terms_of_use":"KetentuanPenggunaan","privacy_policy":"PernyataanPrivasi","cookies_policy":"KebijakantentangCookiedanTeknologiSejenis","langue":"Bahasa","edit_profile_name_between_length":"Harusberisiantara3hingga30karakter","edit_profile_about_between_length":"Harusberisiantara5hingga200karakter.","edit_profile_about_not_email":"Jangansertakanalamatemail","edit_profile_about_note_url":"JangansertakanURL","edit_profile_about_not_phone":"Jangansertakannomortelepon","enter_code_error":"Harusberisiantara4","my_account_profile_picture_title":"Gambarprofil","profile_basic_information":"Informasidasar","profile_contact_information":"Informasikontak","profile_optional_information":"Informasiopsional","profile_cta_discard":"Hapus","profile_cta_se_changes":"Simpanperubahan","profile_tip_basic_information_title":"Kenapainipenting?","profile_tip_basic_information_description":"{brand}dibangunataskepercayaan.BantuoranglainmengenalAnda.Ceritakanpadamerekatentanghal-halyangAndasukai.Bikanmerek,buku,film,pertunjukan,musik,makananforitAnda.DanAndaakanmelihathasilnya...","profile_tip_phone_description":"Iniadalahnomoruntukkontakpembeli,pengingat,dannotifikasilainnya.","profile_tip_phone_verified":"AndatelahmemverifikasiteleponAnda.HaltersebutpentinguntukmemungkinkankamiberkomunikasidenganAndadenganaman.","profile_tip_facebook_description":"MasukdenganFacebookdantemukankoneksitepercayaAndauntukpembeli","profile_tip_google_description":"Connect{brand}akunkeakunGoogleuntukkesederhanaandankemudahan.","profile_cta_disconnect":"Disconnect","profile_cta_connect":"Connect","profile_cta_connect_facebook":"ConnectFacebook","profile_cta_connect_google":"ConnectGoogle","profile_facebook_connected_description":"TerhubungkeakunFacebookAnda","profile_google_connected_description":"TerhubungkeakunGoogleAnda","profile_facebook_description":"HubungkanakunFacebookAnda","profile_google_description":"HubungkanakunGoogleAnda","account_exists_phone_title":"MasukkannomorteleponuntukmemverifikasiakunAnda","account_exists_email_title":"MasukkanemailuntukmemverifikasiakunAnda","account_exists_title":"Akunsudahada","account_exists_subtitle":"Sudahadaakunlaindengannomortelepon\u002Falamatemailini.JikaAndainginmenggunakannomortelepon\u002Femailini,silakanmasuklangsungmenggunakannya.","profile_picture_tip_text":"Fotoyangjelaspentingbipembelidanpenjualardapatsalingmengenali.PastikantidakmenyertakaninformasipribadiatausensitifapapunyangtidakinginAndaperlihatkan.","profile_picture_tip_bold":"Tidakbegitumenyenangkanchatdalamkeadaanbosan!","profile_picture_upload":"Unggah","profile_picture_import_facebook":"ImpordariFacebook","profile_picture_import_google":"ImpordariGoogle","or":"atau","profile_completion_step_singular":"{stepsLeft}langkahli","profile_completion_step_plural":"{stepsLeft}langkahli","profile_completion_explanation":"{brand}dibangunataskepercayaan.BantuoranglainmengenalAnda.Ceritakanpadamerekatentanghal-halyangAndasukai.","enter_password":"Masukkankatasandi","create_password_rule":"Gunakanminimal6karakterdengansetidaknya1angkadan1huruf","create_password_rule_mobile":"Gunakanmin6karakterdengan1angkadan1huruf","old_password_wrong":"Katasandilamasalah","change_password_title_bar":"Gantikatasandi","change_password_current_placeholder":"Katasandisaatini","change_password_new_placeholder":"Katasandibaru","change_password_confirm_placeholder":"Konfirmasikatasandibaru","change_password_feedback_success":"Andatelahberhasilmengubahkatasandi","create_password_feedback_success":"Andaberhasilmembuatkatasandi","change_password_logout_all_feedback_error":"KatasandiAndatelahberhasildiubah.DemikeamananakunAnda,pilih'Keluardarisemuaperangkat'setelahbeberapamenit.","account_merging_merge_title":"Ups!Nomorteleponinisudahdigunakanoleh{user}","account_merging_posting_sub":"NomorteleponyangsedangAndacobagunakansudahdikaitkandenganakunlain{brand}.AndabisamenggabungkanakunAndajikaingin.","account_merging_switch_sub":"NomorteleponyangsedangAndacobagunakansudahdikaitkandenganakunlain{brand}.Andaharusloginkeakunyanglaindanlogoutdariakunsaatini.","account_merging_link_sub":"NomorteleponyangsedangAndacobagunakansudahdikaitkandenganakunlain{brand}.Harapgunakannomorteleponlainuntukmelanjutkan","account_merging_cta_use_another":"Gunakanteleponlain","account_merging_cta":"Gabungkanakun","account_merging_cta_switch":"Beralihakun","account_merging_dialog_merge":"AndaakanmenggabungkanakunAnda","account_merging_dialog_switch":"Andaakankehilanganprogrespemasanganiklanyangsedangberlangsung","account_merging_dialog_cancel":"Batalkan","account_merging_dialog_continue":"Lanjutkan","account_merging_posting_feedback":"AkunAndaakansegeradigabungkan","account_merging_merge_title_email":"Ups!Emailinisudahdigunakanoleh{user}","account_merging_link_sub_email":"EmailyangsedangAndacobagunakansudahdikaitkandenganakun{brand}lain.Harapgunakanemaillainuntukmelanjutkan","account_merging_cta_use_another_email":"Gunakanemaillain","details":"Detail","postedIn":"Lokasiiklan","showPhone":"Tampilkannomor","chatWithSeller":"Chatdenganpenjual","bookTestDrive":"Booktestdrive","viewTestDrive":"Viewtestdrive","sellerDescription":"Deskripsipenjual","itemRelatedAds":"Iklanterkait","seeProfile":"Lihatprofil","postedOn":"DipostingPada","postedBy":"Dipasangoleh","features":"FiturKhusus","showLess":"TampilkanLebihSedikit","showAll":"TampilkanSemua","overview":"Ikhtisar","dealerVerifiedSeller":"Penjualterverifikasi","soldBy":"Dijualoleh","postBy":"Postinganoleh","leadGenTxt":"Sayatertarik","profileLinkTxt":"LihatProfilPenjual","emiFromTxt":"Dari","priceCardMonth":"bulan","emiFullText":"Mulaidari{amt}perbulan","consumerFinanceLink":"BukaKeuangan","downPaymentTxt":"Uangmukadari","priceCardEmi":"Nilaibiaya","priceCardLabel":"Nilaimobil","priceCardDownPayment":"Tunai","priceCardConsumerFinanceLink":"Berjaminan","profile_noAdsTitle":"TidakadaIklan","profile_noAdsText":"Ketikapenggunamemasangiklan,akanmunculdisini.JikaAndainginmemasangiklan,Andadapatmelakukannyasekarang","facebook":"Facebook","google":"Google","also_followed_by_more":"{users}dan{more}lainnya.","also_followed_by_and":"{users}dan{user}lainnya.","also_followed_by":"Jugadifollowoleh","shareProfile":"Bikanprofil","copiedToClipboard":"Disalin!KamitelahmenyalinnyakepapanklipAnda","amenities":"Fasilitas","more":"Lainnya","parametersLabel":"HalPentingyangPerluDiketahui","projectDescLabel":"TentangProyek","builderLabel":"TentangBuilder","builderSubLabel":"Dikembangkanoleh{name}","amenitiesTitle":"Fasilitas","locationLabel":"Lokasi","locationFooter":"Klikpadapetauntukmemperbesar","floorPlan":"Denah","readMore":"BACASELENGKAPNYA","reraApproved":"DISETUJUIRERA","approvedBanks":"PersetujuanBank","enquireButton":"TanyakanSekarang","reraRegistrationNo":"NomorRegistrasiRERA","approvingAuth":"OtoritasyangMenyetujui","constructionMat":"BahanBangunan","unitBuiltupInfo":"AreaSuperLuas","unitCarpetArea":"AreaKarpet","unitTotalArea":"Daerah","unitBedroom":"Kamartidur","unitBathroom":"KamarMandi","unitBalcony":"Balkon","promoted":"disponsori","projectLastUpdated":"Terakhirdiperbaruipada","disclaimerTitle":"Penafian","projectHighLightTitle":"Highlight","projectDescTitle":"DeskripsiProyek","launchedProjects":"SemuaProyek","otherAmenitiesTitle":"FasilitasLainyangTersedia","fieldLength":"Panjangharus{count}karakter.","leadFormMesseTitle":"PesanBerhasilDikirim","leadFormSubmitMesse":"PesanAndatelahberhasildikirimkebuilder.SeseorangdaritimmerekaakanmenghubungiAndadalam24jam.","continueBrowsingButton":"LanjutkanPenjelajahan","aboutProject":"TentangProyek","projects":"Proyek","projectsResultsIn":"{total}proyekmasuk","categoryBrowsingTitle":"Telusurikategori","noConnectivity":"Harapcobalinanti!","projectDetailsTitle":"{projectName}oleh{builderName}-Proyekdi{city},{country}-{projectId}","projectListingTitle":"{filter}dalam{location}","projectListingDesc":"Temukan{filter}di{location}.ProyekPerumahan&HunianBarudi{currentLocation}","leadFormAutosubmitText":"MembikandetailkontakAnda...","reskinOnboardingTitle":"Selamatdatangkembali","reskinOnboardingText":"Tampilanbaru,{brand}kerenyangsama.","reskinOnboardingLink":"Pelajarilebihlanjut","reskinOnboardingAction":"Ayo","onBoardingLocationMesse":"KetukdisiniuntukmengubahlokasiAndaataucaridiseluruhnegara","onBoardingLocationTitle":"Pilihlokasi","android_app_store_alt_text":"Unduh{brand}diAndroidPlayStore","apple_app_store_alt_text":"Unduh{brand}untukiOSdiAppleAppStore","adsResultsIn":"{total,number}iklanmasuk","safetyTips":"TipsKeamanan","filterTitleMakeAndModel":"MerekdanModel","filterTitleMake":"Merek","provinces":"Provinsi","locationErrorTooltip":"MohonmaafkamitidakbisamenentukanlokasiAnda","locationErrorTooltipTry":"Silakancobali.","filterTitleWithChildren":"{parent}dan{children}","searchOnlyIn":"Hanyadi{name}","geolocation_blocked":"Geolokasidiblokir","geolocation_blocked_description":"SepertinyaizingeolokasiAndadiblokir.HarapberikanaksesgeolokasipadapengaturanbrowserAnda.","backToTop":"Kembalikeatas","login_service_unailable":"Layananiniuntuksementaratidaktersedia.SilakancobametodeMasuklain.","login_user_banned":"AkunAndaditangguhkan","login_unauthorized":"AkunAndatidakdiizinkanlogin","login_invalid_token":"Kodeyangdimasukkansalah","login_invalid_password":"KatasandiAndasalah","login_expired_token":"SesiAndatelahberakhir","login_invalid_user":"AkunAndatidakvalid","login_too_many_requests":"Terlalubanyakpercobaanlogin.Cobalidalam10menit.","login_unknown_error":"Kesalahanlogintidakdiketahui","freshRecommendations":"Rekomendasibaru","profile_flow_name_title":"SiapanamaAnda?","profile_flow_name_desc":"\"Orangasing\"terasasangattidakpribadi,Andatahu?","profile_flow_name_desc_mxcl":"arkamitahubaimanakamimenyebutAnda","profile_flow_name_input":"NamaatauNamaPanggilan","profile_flow_number_title":"BerapanomorteleponAnda?","profile_flow_number_desc":"Andaakanmenggunakannyauntuklogindanhal-halumum.KamiakanmengirimkankodekenomorhandphoneAnda","profile_flow_number_input":"MasukkannomorHP","profile_flow_email_title":"ApaemailAnda?","profile_flow_email_desc":"Andaakanmenggunakannyauntuklogindanhal-halumum.KamiakanmengirimkankodekealamatAnda","profile_flow_email_input":"Alamatemail","profile_flow_bio_title":"AdahallaintentangAnda?","profile_flow_bio_input":"ApapekerjaanAnda?ApayangAndalakukansaatluang?","profile_flow_picture_title":"Tambahkangambarprofil","profile_flow_picture_desc":"TunjukkanpadayanglainbetapakerennyaAnda","profile_flow_picture_import":"Impordari","profile_flow_picture_import_or":"Atauimpordari","profile_flow_connections_title":"Koneksi","profile_flow_connection_desc":"BiarkantemanAndaterusmendapatinformasitentangbarangOOLXAndadijejaringsosialAnda","profile_flow_success_title":"Oke!","profile_flow_success_desc_1":"AkunAndasudahdiatur.","profile_flow_success_desc_2":"selamatdatangdiOLX","finish":"Selesaikan","HaTSTitle":"BantukamimeningkatkanOLX!","HaTSCancelButton":"JanganSekarang","HaTSAcceptButton":"IKUTISURVEIKAMI","placeholderSearchInputIn":"Dalam{locationName}","placeholderSearchInputNear":"Didekat{locationName}","placeholderSearchInputNearYou":"didekatAnda","placeholderSearchInputAllAdsIn":"Semuaiklandi{locationName}","placeholderSearchInputAllAdsNear":"Semuaiklandidekat{locationName}","placeholderSearchInputAllAdsNearYou":"SemuaiklandidekatAnda","adsResultsNear":"{total,number}iklanterdekat","adsResultsCurrentLocation":"{total,number}iklan","nearYou":"didekatAnda","relaxationBucketLessThan":"Menampilkaniklandalam","relaxationBucketGreaterThan":"Menampilkaniklandilebihdari","fromLocation":"Dari{location}","awayFromLocation":"dari{location}","fromYou":"dariAnda","awayFromYou":"jauhnyadariAnda","relaxationPolygonNoResults":"Sayangnyakamibelummenemukanapapundi{location}.","relaxationPolygonNoResultsNearYou":"SayangnyakamibelummenemukanapapundidekatAnda.","relaxationPolygonDisplayingResults":"Menampilkaniklandi","reviews_rate_title":"BaimanaperasaanAndamengenai{username}?","reviews_rate_desc":"Pilihsatuopsidibawahini","reviews_rate_bad":"Buruk","reviews_rate_good":"Bus","reviews_rate_excellent":"Luarbiasa","reviews_feedback_desc":"Pilihhingga3opsi","reviews_feedback_rating_bad_title":"Apayangmembuatnyaburuk?","reviews_feedback_rating_good_title":"Apayangmembuatnyabaik?","reviews_feedback_rating_excellent_title":"Apayangmembuatnyaluarbiasa?","reviews_feedback_to_improve_title":"Adakahyangperluditingkatkan?","reviews_feedback_to_improve_desc":"Halyangbisadilakukanpenjualdenganlebihbaik","reviews_did_buy_title":"ApakahAndaakhirnyamembelidari{username}?","reviews_did_buy_yes":"Ya,sayasudahmembeli","reviews_did_buy_no":"Tidak,kamitidakbisa","reviews_more_info_title":"HallainyanginginAndatambahkan?","reviews_more_info_desc":"Kamitidakakanmembikandenganpenjual,janganru...","reviews_success_desc":"Terimakasihuntukmasukannya","reviews_success_cta":"Lanjutkandantutup","reviews_error_desc":"Adayangtidakberes","reviews_step_counter":"Langkah{number}","reviews_step_rate":"Nilai","reviews_step_feedback_rating":"Detail","reviews_step_feedback_toImprove":"Untukmeningkatkan","reviews_step_boughtIt":"ApakahAndamembeli?","reviews_step_moreInfo":"Lainnya","reviews":"Ulasan","reviews_from_other":"{number}Ulasandaripenggunalain","reviews_empty_title":"Belummemilikiulasan","reviews_empty_desc":"PembelidapatmeninggalkanulasantentangpengalamandenganAnda.","reviews_evaluations_title":"{number}evaluasi","reviews_rate_bad_num":"Buruk({number})","reviews_rate_good_num":"Baik({number})","reviews_rate_excellent_num":"Sangatbaik({number})","reviews_should_improve":"Harusmemperbaiki:","reviews_feedback_list":"{list}dan{last}.","cover_advanced_search":"Pencarianlanjutan","cover_error_subtext":"Adayangtidakberes.Mohonmaaf.","cover_error_action":"CobaLi","disclaimer_text":"Maaf,saatinikamitidakdapatmemberiAndaperkiraanharga.KamidapatmemberikanAndapenawaranhargasetelahpemeriksaandanlelanggratisselesai.PesanjanjitemuuntukmemeriksadanmenjualmobilAndasekarang.","contact_me_text_offer":"Andaakanmendapatkanpenawaranakhirsetelahprosesinspeksidanlelangdisalahsatupusatinspeksikami.Pesanjanjitemuuntukmemeriksa&menjualmobilAndasekarang.","contact_me_title":"Pesaninspeksigratisuntukmendapatkanhargaakhir","contact_me_button":"Hubungisayauntukmemesanwaktunya","contact_me_checkbox":"JugapasangiklanonlinediOLX","quotation_title":"NilaimobilAndaadalahantara:","contact_me_pe_title":"Andahampirselesai","contact_me_post_button":"PasangiklanonlinediOLX","contact_me_skip_button":"Lewati","contact_me_success":"SeorangpemeriksaakansegeramenghubungiAnda","get_started_pe_title":"Mulai","get_started_title":"JualdiTokoCashMyCardandapatkanuangtunaiinstan","get_started_cmc_button":"Dapatkannilaimobilsaya","get_started_sell_online":"JualonlinelewataplikasiOLX","get_started_subtitle":"ardilihatolehribuanpengguna","get_started_post_online":"PasangiklanonlinediOLX","information_pe_title":"Cashmycar","information_make":"Merek","information_model":"Model","information_year":"Tahun","information_trim":"Trim\u002FVarian","information_location":"Kondisiterdaftarkendaraan","information_car_city":"Lokasimobil","information_milee":"Jaraktempuh","information_phone":"Telepon","information_submit":"NilaiMobilsaya","information_error":"Telahterjadikesalahan.Silakancobali.","information_featured_make":"Merekteratas","information_options_make":"MerekA-Z","preNotificationDesktopTitle":"Janganlewatkanapapun!","preNotificationDesktopLink":"Aktifkanpemberitahuandesktop","preNotificationDesktopText":"dannikmatiOLXsepenuhnya","preNotificationMobileTitle":"Janganlewatkanapapun","preNotificationMobileText":"DapatkannotifikasisaatAndamendapatjawaban.","preNotificationMobileLink":"Izinkan","download_app_title":"CobaAplikasiOLX","download_app_subtitle":"Beli,jual,dantemukanapasajamenggunakanaplikasidihandphoneAnda.","download_app_title_links":"DownloadaplikasiOLXhariini","my_account_view_profile":"Lihatdaneditprofil","gallery":"Galeri","list":"Daftar","mosaic":"Mozaik","add_to_home_install":"InstalaplikasiOLXLite","seAndCompareItemsShort":"Simpandanbandingkanbarang","seAndCompareItemsLong":"SekarangAndadapatmenyimpandanmembandingkanbarang","addItems":"TambahkanbarangyangAndaminati,untukditinjauataudibelinantidalam\"Foritsaya\"","discoverItems":"Temukanbarang","requestNumber":"MintaNomor","numberRequested":"NomoryangDiminta","declineRequest":"TolakPermintaan","shareContactDetails":"BikanDetailKontak?","requestCallDefaultMsg":"HarapbikandetailkontakAnda","acceptedCallRequestMsg":"Andasekarangdapatmenghubungisayadi{phone}","rejectedCallRequestMsg":"Maaf,sayatidakdapatmembikandetailkontaksaya,kitadapatmelanjutkanlewatobrolan","scheduleCallDefaultMsg":"Sayatertarik,haraphubungisayadi{phone}.","shareContactWarning":"SelalupastikanAndaamandiOLXdanwaspadalahterhadapIDpalsu,kecurangan,danpenipuan.","shareConatctWarningConfirmation":"YakininginberbidetailkontakAndadenganpembeliini?","cancelShareContact":"Batalkan","shareContactText":"Bikankontak","shareContact":"Bikan","rejectContactSharing":"Penjualbelummembikandetailkontaknya.Andaharusterusmenghubungipenjuallewatobrolan","requestContactain":"Andasudahmemintanomorpenjual.Penjualmasihbelummenanggapipermintaantersebut.KamiakanmemberitahuAndaketikapenjualmerespons.Andadapatterusmenggunakanobrolanuntukmembahasprodukdenganpenjual.","enterOtherNumber":"Masukkannomorlain","_comments":"PengarahanLokasi","onboardingTitle":"DimanaAndainginmembeli\u002Fmenjualproduk?","onboardingCarsTitle":"DimanaAndainginmembeli\u002FmenjualMobil?","onboardingSubtitle":"UntukmenikmatisemuayangditawarkanOLXkepadaAnda,kamiharustahudimanamencarinya.","onboardingGPSText":"Didekatsaya","onboardingManualText":"ALAMATLAINNYA","locationBlocked":"AkseslokasiAndadiblokir","locationBlockedDetail":"SepertinyaizinlokasiAndadiblokir.HarapberikanakseslokasidipengaturanbrowserAndadandapatkaniklanterdekat","okGotIt":"Oke,Paham","acceptOffer":"SayaterimapenawaranAnda.Marilanjutkanketransaksiakhir","rejectOffer":"Maaf,sayatidakbisamenjualbarangdenganhargaini,Tolongberisayapenawaranyanglebihbaik.","counterOfferBody":"Sayadapatmenjualbaranginiseharga{price},MohontambahpenawaranlamaAnda","makeOfferBody":"Sayainginmembelidenganharga{price}","editOfferBody":"Sayasekaranginginmembeliiniseharga{price}","filterTitle":"Filter&Sortir","defaultCatName":"Pilih","appliedFiltersText":"Filteryangdipilih","changeView":"UbahTampilan","changeSort":"UbahSortiran","filterCancelTitle":"Tindakaniniakanmenghapusperubahanyangdilakukanuntukpemilihanfilter","all_filters":"Semuafilter","view_all_filters":"Lihatsemuafilter","quickFiltersOpenText":"LebihSedikit","quickFiltersCloseText":"Lainnya","changeCategoryTitle":"Mengubahkategoriakanmenghapussemuapilihanfilter","changeCategoryCancel":"Kembali","catDeclineText":"Kembali","catApplyText":"Lanjutkan","catPopupTitle":"Menerapkankategoribaruakanmengaturulangfilter","noInternetTitle":"Koneksiinternetterputus!","noInternetSubtitle":"HarapperiksakoneksiinternetAndauntukmelanjutkan","errorSubtitle":"Ups!Adayangtidakberes,kamisedangmenyelidikinya.","bannerTitle":"Kenaliapayangpalingpenting","questions":"pertanyaan","testcommitain":"iniadalahkomittes.Silakancobalinanti","testcommitcontainer":"migrasismartlingkeujikomitmenwadah","testcommitcontainernew":"migrasismartlingbarukeujikomitmenwadahbaru","inspectedCar":"LulusInspeksi","ttCarBody":"KondisimobilsudahdiperiksaolehtimahliOLXAutosuntukmemastikankualitasnya.","ttCarFooter":"Nikmatitransaksimobilyangamandannyaman!","wishlist":"Daftarkeinginan","__comment-OLXAutos":"terjemahanhalamanotomatis","carDetails":"DetailMobil","storeDetails":"DetailToko","selfInspectionErrorText":"SayangnyakamitidakbisamembelimobilAnda,sehinggakamitidakdapatmelanjutkanevaluasijarakjauh.KamimenghargaiAndamenjadikankamisebaiopsiuntukmenjualmobil.","selfInspectionContact":"JikaAndamemilikipertanyaanataukomentar,Andadapatmenghubungikamidi:","dateSectionTitle":"Pilihtanggaldanwaktu","ailableSlots":"SlotyangTersedia","ailableSlot":"SlotyangTersedia","confirmBooking":"Konfirmasi","nearestStore":"TokoOLXyangdirekomendasikan","approxDistKM":"Sekitar{distance}km","approxDistKMS":"Sekitar{distance}KM","fromYourLocation":"darilokasiAnda","chooseCity":"PilihKota","chooseStore":"PilihTokoOLX","appointmentConfirmed":"Bookingdikonfirmasi","appointmentCancelled":"Bookingdibatalkan","homeAppointmentConfirmed":"Kunjungankerumahdipesan!","homeAppointmentCancelled":"InspeksidiRumahdibatalkan","homeInspection":"InspeksidiRumah","headingStoreInspection":"StoreInspection","headingHomeInspection":"HomeInspection","addressHeading":"PeriksakanmobilAndadirumah","locationInspection":"LokasiAnda","addressSubHeading":"AlamatAnda","addressHouse":"AlamatAnda*","addressHouseMap":"Nomor&gedungRumahAnda","addressLandmark":"Penunjuk","ailableDates":"Tanggalyangtersedia","homeAdress":"AlamatInspeksidiRumah","homeInspectionSubHeading":"SeorangahliOLXAutosakanmengunjungirumahAnda.","postFreeAd":"Pasangiklangratis","addressPlaceholder":"misalnyaTowerA-202","addressLandmarkPlaceholder":"misalnyaseberangrumahsakitMax","noHomeInspectionHeading":"JualdariRumahtidaktersedia","noHomeInspectionSubHeading":"Maaf!KamitidakmenawarkankunjunganRumahdilokasiAnda.AndadapatmengubahlokasiAnda","locationPlaceHolder":"PilihKotaAnda","submit":"Kirim","bookStoreInspection":"Pilihlokasi,tanggaldanwaktu","buttonDisclaimer":"*Hargaakhirtergantungpadahasilinspeksimobil","postAdWithLocationChange":"AndadapatmencobalokasilainatautetapmemasangIklanuntukmenjangkauribuanpembelisecaraonline","appointmentConfirmedSub":"KamitidaksabarbertemudenganAnda","dateAndTime":"Tanggal&Waktu","reschedule":"Jadwalkanulang","address":"Alamat","getDirections":"Dapatkanpetunjuk","callCenter":"PusatPanggilan","daysLeft":"{daysLeft}harili","dayLeft":"{daysLeft}harili","sellYourCar":"JualmobilAndadicabang","store":"terdekat","ailableDateSlotsErrMsg":"Harappilihtanggal","ailableTimeSlotsErrMsg":"Harappilihslotwaktu","disclaimer":"Denganmengklikkonfirmasipemesanan,AndadenganinimenyetujuiS&KdanKebijakanPrivasiSobekAutoIndiaPvtLtd.","disclaimerWithTncLink":"SayasetujudenganKebijakanPrivasidan{tncLink}","disclaimerWithLinks":"{tncLink}","disclaimerWithLinksCF":"Sayasetujudengan{privacyPolicyLink}dan{tncLink}","privacyPolicies":"KebijakanPrivasi","sorryTxt":"Maaf!SaatinikamitidakmemilikipusatOLXyangtersediadikotaAnda","proceedTxt":"AndadapatmelanjutkandenganmencantumkaniklanAndadiolx.","alreadyBooked":"Andasudahmemilikipemesananuntukakunini.","viewExisting":"LihatpemesananAndasaatini","notice":"KamiperhatikanAndamemilikipemesananaktif.Inginmelihatataumengubahpemesananyangsudahada?","loginNotice":"Saatinikamumemilikipemesananyangaktif.Silakanmasukuntukmelihatataumengubahpemesananyangsudahada?","cancelAppointment":"Yakininginmembatalkan?AndajugadapatmenjadwalkanulangpemesananAnda","locatingStore":"Memeriksaslotyangtersedia","noSlots":"Ups!TidakAdaSlotTersedia.","valuationHeading":"Masukkandetailuntukmendapatkanharga","select":"Pilih","mobilePlaceHolder":"Masukkannomorponsel","userLocationLabel":"MasukkanlokasimobilAnda","mobileError":"Masukkannomorponselyangvalid","mobileRequired":"Nomorponseldiperlukan","valuationFooter":"Kamitidakmembelimobilkomersial.","make":"Merek","model":"Model","variant":"Varian","registeredState":"Statuspendaftaran","year":"Tahunpendaftaran","first_owner":"JumlahPemilik","milee":"Kmtelahdilalui","valuationButton":"CekHargaJualMobil","valuationError":"Silakanisikolomyangkosonguntukmenghitunghargamobil","loaderHeading":"JualmobilAndadalam1kunjungan","loadersubHeading":"diTokoOLX","valuationSubHeading":"Menganalisisharga40.000+mobilserupa","valuationSubHeading1":"MenghitungnilaiterbaikmobilAnda","valuationSubHeading2":"HargaPasarAsliOLX","allBrand":"SemuaMerek","popularBrand":"MerekPopuler","mobileText":"Handphone","valuateDisclaimer":"Denganmengklik\"Dapatkanhargamobil\",AndamenyetujuiKetentuandanKebijakankami.","cancelBooking":"Batalkanpemesanan","postAdNow":"Pasangiklansekarang","exitTitle":"Keluartanpamenjual?","exitText":"TinggalbeberapalangkahlisampaiAndadapatmenjualmobilAnda","contactText":"NomorkontakAnda","valuationFooter1":"Kamitidakmembeli","valuationFooter2":"mobilkomersial.","bestPriceText":"MenghitunghargaterbaikmobilAnda","similarCarPrice":"Menganalisisharga40.000+mobilserupa","showAllValuation":"TampilkanSemua","contactUsQuery":"Hubungikamijikaadapertanyaan","disclaimerPopularBrands":"MerekdanlogoyangdigunakanadalahmerekdangterdaftaryangtidakdimilikiolehOLXAutos\u002FFrontierCarGroupMéxico,SAdeCV,adalahmilikdarimasing-masingpemilikyangterdaftardiotoritasyangberwenang.Penggunaanmerekdanlogodiplatforminihanyauntuktujuaninformasidanbukanuntukpromosi.","fetchingOlxStores":"Mohontunggu...kamisedangmengambiltokoOLXAutosterdekatberdasarkanlokasiAndasaatini","rescheduleSuggestion":"JikaAndainginmenjadwalulangpemesanan,harapaturulangpemesanandenganmengkliktombolJadwalkanUlang","enterPhoneNumberO2O":"NomborHPtanpa'0'didepan","privacyInfo":"Kamimenghormatiprivasi,daninformasiAndaamanbersamakami","plateNumber":"PelatNomor*","plateValidateMesse":"Hanya8karakter","platePlaceholder":"MasukkanPelatNomor","plateError":"PelatNomorDiperlukan","plateInfo":"Pelatnomorharusterdiridarihurufdanangkadantidakbolehlebihdari8karakter.","plateNext":"Lanjut","sliderHeadline":"LulusInspeksi","olxAutosSliderHeadline":"MobilOLXAutos","condition_modal_title":"Apaartikondisimobil?","car_condition_fair":"Cukup","car_condition_good":"Bus","car_condition_excellent":"Luarbiasa","car_condition_query_scratches":"Tidakadagoresandibadan","car_condition_query_upholstery":"Tidakadakerusakanpadapelapis","car_condition_query_electronics":"Elektronikyangberfungsipenuh(jendela,kunci,dll.)","got_it":"Oke","onlineBannerText":"Andakembalionline","offlineBannerText":"Andasepertinyaoffline","true_market_price":"HargaSebenarnya","true_market_price_r3":"penawaranterbaik","additionalBenfits":"Manfaatlaindari","vasDisclaimer":"LihatSyarat&Ketentuanuntukdetailselengkapnya","selectLocation":"Pilihlokasiuntukmelanjutkan","selectStore":"Pilihlokasi","slotAndTime":"Tanggaldanwaktu","bookingsubText":"Jualmobildenganinstan,amandannyamandiOLXAutos","storeInsSubText":"Kunjungitokokamidenganhargaterbaik","appointmentDetails":"DetailBooking","storeAaddress":"Alamat","enterContactDetails":"Tinggalselangkahli,nih.YukdapatkanhargamobilAndasegera!","emailId":"Email","enterNumber":"Masukkannomortelepon","enterEmailId":"MasukkanEmail","emailRequired":"EmailHarusDiisi","exampleValue":"Misalnya{value}","zoopPlaceHolder":"MasukkanNomorMobilmisalnya{value}","chooseACity":"Pilihkota","searchLocationPlaceholder":"Carilokasi","enterYourCarLicense":"BerapanomorpelatmobilAnda?","numberPlateHeader":"3xlebihcepat","zoopTextInfo":"DetailAndaamanbersamaOLXAutos","listView":"TampilanDaftar","mapView":"TampilanPeta","detailsLabel":"Detail","directionLabel":"Petunjuk","getDirectionButtonLabel":"Dapatkanpetunjuk","scheduleAnAppointment":"JadwalkanJanjiTemu","serviceHoursLabel":"JamLayanan","closedLabel":"Tutup","scheduleInspectionBtnLabel":"JadwalkaninspeksiAndadisini","monday":"Senin","tuesday":"Selasa","wednesday":"Rabu","thrusday":"Kamis","friday":"Jumat","saturday":"Sabtu","sunday":"Minggu","telephoneLabel":"TELEPHONO","totalCentresLabel":"Kamimemiliki{{count}}titikpembeliandi'{{cityName}}'","loginLead":"Hai,saya{name}.Sayabisadihubungidi{phone}","successHeaderContactTitleSI":"Hubungiuntukmemperolehbantuan","successHeaderContactSubTitleSI":"Jangankhawatir,kamidengansenanghatimembantuAnda.HubungikamidinomoOLX Pusatnya Nge-Dealr-nomorberikut","requiredFieldSI":"wajib","optionRadioYesSI":"Ya","optionRadioNoSI":"Tidak","onlineAssessmentHeaderSI":"ApayangterjadiselamaPenilaianOnline?","onlineAssessmentHeaderSIPoint1":"SeorangpenasihatakanberkomunikasidenganAndamelaluipanggilanvideo","onlineAssessmentHeaderSIPoint2":"LakukanevaluasikeadaanmobilAndasaatini","onlineAssessmentHeaderSIPoint3":"MemberiAndapenawaranawal","onlineAssessmentHeaderSIPoint4":"KamimeninjaukondisiumumkendaraandanmemberikanpenawaranterakhirkepadaAnda","onlineAssessmentHeaderSIPoint5":"Andamemutuskanapakahinginmenjual,tidakadakewajibanapapun","onlineAssessmentHeaderSIPoint6":"JikaAndamenerima,kamiakanmembantuprosedurnya","onlineAssessmentHeaderSIPoint7":"KamisegeramentransferuangkeakunAnda","onlineAssessmentHeaderSIPoint8":"Cerdas!","whatsappConnectButtonSI":"TerhubungmelaluiWhatsapp","whatsappConnectHeaderTitleSI":"Andabutuhbantuan?","whatsappConnectHeaderSubTitleSI":"HubungikamidiWhatsappuntukdetailbantuanlangsungdarijanjitemu.","nextButtonSI":"Pilihtanggal&jam","selfEvaluationTitle":"PenilaianMandiri","selfEvaluationSubTitle":"JawablahbeberapapertanyaanperihalmobilAndauntukmendapatkanhargayanglebihbaik","thankYouUserTitle":"Terimakasih!","thankYouUserSubTitle":"KamimengirimkankonfirmasikeemailAndabesertadetaillainnya","backButtonSI":"Kembali","licenseNumberRequired":"PelatNomorharusdiisi","licenseNumberError":"BukanPelatnomoryangvalid","storeNotFoundTitle":"Tokotidakditemukan","storeNotFoundDesc":"Tidakditemukantokodilokasiyangdipilih,harappilihlokasilain","noLocationSelected":"Tidakadalokasiyangdipilih","selectLocationDesc":"Pilihlokasiuntukmelanjutkaninspeksitoko","noSlotailable":"Ups!TidakAdaSlotTersedia.","schedulingAppointment":"MenjadwalkanjanjitemuAnda","fetchingYourAppointment":"MengambildetailjanjitemuAnda","switchInsHeadHomeTxt":"PakaiHomeInspection","switchInsHeadHomeSubTxt":"Klikdisiniuntukmemesan","switchInsStoreStoreTxt":"Inspeksidicabangterdekat","switchInsHeadStoreSubTxt":"Klikdisiniuntukmemesan","inspectionBookingSite":"BeralihkeInspeksi{site}","tabSwitchInspection":"Ketukdisiniuntukmemesaninspeksi{site}","nearestStoreLocation":"Lokasiterdekat","tapChooseStore":"Ketukdisiniuntukmemilihdaridaftarsemuatoko","storeNotFound":"TidakdapatmenemukantokodidekatAnda?","bookHomeInspection":"InspeksidiRumah","homebookingsubText":"PemeriksaanditempatAnda","enterAddressDetails":"MasukkanDetailAlamat","notFoundV2ErrorTitle":"Statuskesalahan404","notFoundV2ErrorDescription":"Halamanyangdimintatidakada.TautanyangAndaklikmungkinrusakatauhalamanmungkintelahdihapus","notFoundV2HomeButtonLabel":"Kembalikeberanda","faq_placeholder":"ApapertanyaanAnda?","startSelfInspection":"MulaiInspeksiMandiri","exchangeCar":"TukarkanmobilAndamelaluikami","enterName":"NamaLengkap","mandatoryFields":"BidangyangHarusDiisi","applied":"diterapkan","exchangeCarSubtitle":"JualmobillamaAndadanbawapulangmobilimpianAnda.","thankYouSubtitle":"KamisudahmenerimapermintaanpenukaranAnda.KamipastiakanmenghubungiAndauntuklangkahselanjutnya.","exchangeThankYouSubtitle2":"KamisudahmenerimapermintaanAnda.KamiakansegeramenghubungiAnda.","exchange":"Tukar","leadGenModalHeading":"BerikaninformasiAndakepadakamidanseorangpenasihatakanmenghubungiAnda","interestedThankYouSubtitle":"KamisudahmenerimapermintaanAnda.KamiakansegeramenghubungiAndauntuklangkahselanjutnya.","interestedFinanceThankYouSubtitle":"KamisudahmenerimapermintaanAnda.KamiakansegeramenghubungiAndauntuklangkahselanjutnya.","submitBtnText":"KirimkanDetail","emailPlaceholder":"abc@mail.com","nameLabel":"NamaLengkap","namePlaceholder":"NamaLengkap","nameFieldLabel":"NamaLengkap","lastNamePlaceholder":"Namabelakang","motherMaidenNamePlaceholder":"Namabelakangibu","requiredFields":"Wajibdiisi","nameRequiredError":"NamaDiperlukan","mandatoryTxt":"BidangyangHarusDiisi","carValueLabel":"HargaMobil","hitchAmtLabel":"UangMuka","creditLabel":"Kredit","emiLabel":"EMI{repaymentPeriod}bulan","instructionTxt":"Belumtermasukbiayatambahan","creditAmtTxt":"KreditAndaadalah","monthsTxt":"{numberOfMonths}bulan","cfheadline":"PeriksaKeuangan","helperTxt":"PilihcicilanbulananAndasesuaiuangmukaAnda.","termsConditionsTxt":"Sayatelahmembaca,mengertidansetujudenganSyaratdanKetentuanyangberlaku","termsAndConditionsApplied":"Syarat&ketentuanberlaku","appliedTxt":"diterapkan","cfThankYouSubTitle":"KamitelahmenerimapermintaankeuanganAnda","buyTabTitle":"Belimobil","sellTabTitle":"Jual​​mobilsaya","financeTabTitle":"Pembiayaan","emailBody":"Hai,\n\nSayainginmelaporkaniklan{itemId}karena_________________\nBerikutdetailkontaksaya:\nNo.telepon:\nIdemail:","reportEmailSubject":"LaporkanIklan{itemId}","sellCar":"JualMobil","buyCar":"BeliMobil","financeYourCar":"BiayaiMobilAnda","faqs":"FAQ","contactUs":"HubungiKami","aboutUs":"TentangKami","viewCarDetails":"LihatDetailMobil","thankYouVeryMuch":"Terimakasihbanyak!","searchCar":"CarimobilforitAnda","empty_bundle_error_title":"Ups,tidakadamobilyangtersedia","empty_bundle_error_desc":"Saatinitidakadamobiltersediadibianini.Kembalilahlinanti.","meeting":"Pertemuan","fofoApprovedDealer":"Dealeryangdisetujui","timings":"Waktu","storeLocation":"Lokasitoko","confirmMeeting":"KonfirmasiTestDrive","cancelMeeting":"BatalkanTestDrive","scheduleMeeting":"Maribertemupada{date}{day}dishowroomAnda.Andadapatmenghubungisayadi","scheduleStoreMeeting":"Maribertemupada{date}{day}dishowroomAnda.Andadapatmenghubungisayadi","unscheduleMeeting":"Maaf,sayatidakbisabertemupada{date},{day}dishowroomAnda.","unscheduleStoreMeeting":"Maaf,sayatidakbisabertemupada{date},{day}dishowroomAnda.","scheduleHomeMeeting":"Maribertemupada{date},{day}untuk{model},{variant}.Andadapatmenghubungisayadi","unscheduleHomeMeeting":"Maaf,sayatidakbisabertemupada{date},{day}untuk{model},{variant}.","meetingConfirmed":"TestDriveDikonfirmasi!","meetingCancelled":"TestDriveDibatalkan!","meetingConfirmedDetail":"MenantiuntukbertemuAndaditoko","meetingCancelledDetail":"PertemuanAndatelahdibatalkan","chatMeetingConfirmed":"PERTEMUANDIKONFIRMASI","chatMeetingCancelled":"Pertemuandibatalkan","viewOrModifyRequest":"Lihatatauubahperjanjian","chatMeetingReschedule":"GantiJadwal","chatCallBuyer":"Hubungipembeli","meetingAtStore":"Pertemuan","transaction":"Transaksi","cancelModalTitle":"BatalkanBooking?","cancelModalSubtitle":"Yakininginmembatalkanpemesananuntuk{carName}?","cancelAnyway":"Batalkan","dontCancel":"Janganbatalkan","confirmed":"Dikonfirmasi","cancelled":"Dibatalkan","storeTestDriveHeader":"Testdrive","storeTestDriveSubheader":"PesantestdriveuntukmobilimpianAndadenganstandarkeamananterbaiksekarang.","pickDate":"PilihTanggal","selectDate":"PilihTanggal","pickDateSubtitle":"Silakanpilihtanggal,timkamiakanmenghubungiAndauntukmengonfirmasijanjitemu.","testDriveDetails":"DetailTestDrive","contactNo":"NomorKontak","homeConfirmationHeader":"Permintaanhometestdriveterkirim!","requestCallBack":"Mohonhubungisayakembali","callNow":"HubungiSekarang","homeConfirmationSubeader":"KamimenantiperjumpaankitadilokasiAnda","serviceFeeStatus":"Statusbiayalayanan","limitedPeriodOffer":"PenawaranPeriodeTerbatas","storeSwapMesse":"DenganmengklikLanjutkan,pemesananuntuktestdrivedirumahakandibatalkan.","homeSwapMesse":"DenganmengklikLanjutkan,pemesananuntuktestdriveditokoakandibatalkan.","sureAboutThis":"Yakintentangini?","meetingDetailsTestDriveCnf":"{type}Testdrivedalam{nDays}harikedepan","meetingDetailsTestDriveCnc":"{type}TestDriveDibatalkan","ReserveDetails":"DipesanolehAnda","testDriveComplete":"{type}TestdriveSelesai","testDriveToday":"{type}Testdrivehariini!","testDriveTomorrow":"{type}Testdrivebesok!","galn_tapOnZoom":"Ketukgambaruntukmemperbesar","spinCarLoading":"Memindaimobildarisetiapsudut...","spinCarToolTip":"Dapatkantampilan360derajatpadamobil","carGallery":"GaleriMobil","makeOfferTitle":"ApakahiniterlihatsesuaidengananggaranAnda?","cf_creditAmtTxt":"Nilaikredittotal","cf_monthsTxt":"{numberOfMonths}Kuotadari","cf_adpv_heading":"MintapersetujuandimukauntukkreditAnda","cf_request_preapproval":"AjukanKreditInstan","cf_intererested":"Sayatertarikdenganpembiayaan","cf_congratulation":"TerimakasihtelahmengajukanKreditInstanBCAFinancemelaluiOLX.","cf_receive_preapproval":"TerimapersetujuandimukamilikAndasegera","cf_modal_title":"KamimensimulasikankreditAndadalambeberapamenit","cf_modal_subtitle":"IsidetailAndadandapatkanpersetujuandimukasecaraonline","cf_modal_heading":"Marikitamulai!Kamihanyabutuhbeberapadata","cf_modal_loading_heading":"KamisedangmenghitungkreditAnda…","cf_modal_success_subheading":"Berikutkamisampaikanhasilscoringaplikasikreditkamu.","cf_modal_pending_heading":"TerimakasihtelahmengajukanKreditInstanBCAFinancemelaluiOLX. ","cf_rejection_heading":"Sesuaikannilainya​​disinisebelummemintapersetujuandimukamilikAnda","cf_rejection_subtitle":"Rupanya,AndatidakmemilikipersyaratanminimumuntukmengabulkankreditkepadaAnda.","cf_rejection_btn":"Mulaipengajuanbaru","cf_pending_title":"KamisedangmenganalisispermintaanAnda","cf_pending_subtitle":"KamiakanmenghubungiAnda","cf_pending_btn":"Mulaipengajuanbaru","cf_thankyou_title":"Terimakasih!","cf_thankyou_subtitle":"KamitelahmenerimainformasiAnda.SeorangeksekutifakansegeramenghubungiAndauntukmelanjutkankelangkahberikutnya.","cf_possible_rejection":"Kemungkinanalasanpenolakan","cf_loading":"KamiakanmemberikanjawabanataspermintaanAnda","cf_modal_total_credit":"Jumlahkredit","cf_modal_upload_documents":"Dokumenyangperlukamivalidasi","cf_modal_how_to_continue":"BaimanaAndainginmelanjutkan?","cf_modal_document_sharing_heading":"BaimanaAndainginkamimenghubungiAnda?","cf_pie":"Kaki","cf_terms":"JangkaWaktu","cf_quota_value":"NilaiKuota","cf_installments":"Iuran","cf_text_form_field_label":"Nama","cf_text_form_field_placeholder":"NamaLengkap","cf_paternal_form_field_label":"Namabelakang","cf_paternal_form_field_placeholder":"Masukkannamabelakang","cf_maternal_name_form_field_label":"Namabelakangibu","cf_email_form_field_label":"Email","cf_email_form_field_placeholder":"abc@mail.com","cf_email_form_field_regex_error":"Masukkanemailyangvalid","cf_phone_form_field_label":"Nomorponsel","cf_phone_form_field_placeholder":"Masukkannomor","cf_phone_form_field_regex_error":"Harapmasukkannomorponselyangvalid","cf_rejected_status_title":"PengajuanKamuBelumMemenuhiKriteriaKredit","cf_rejected_status_subTitle":"PermintaanAndasebelumnyaditolak","cf_between_status_title":"Selesaikanprosesnya!","cf_between_status_subTitle":"TerimapersetujuanAndasecaraonline","cf_identity_screen_title":"MasukkanRUTAndauntukmemberinilaikuotayangdipersonalisasiuntukAnda","cf_identity_field_label":"KamimenjaminprivasiinformasiAnda.","cf_identity_field_placeholder":"TulisRUTAndadisini","cf_identity_field_error_msg":"MasukkanRUTyangvalid","cf_salary_screen_title":"BisakahAndamemberitahukamipenghasilanbersihAnda?","cf_salary_screen_subtitle":"MasukkanpenghasilanbersihAndaarkamidapatmemberinilaikuotayangdipersonalisasi","sal_slider_errorMsg":"AndaharusmemasukkanpenghasilanbersihbulananAnda","cf_sal_tab_emp_status":"Modekerja","cf_sal_tab_dependent":"Dependen","cf_sal_tab_independent":"Independen","cf_sal_tab_emp_duration":"Kontinuitaskerja","cf_sal_tab_morethan6":"6bulanataulebih","cf_sal_tab_lessthan6":"Kurangdari6bulan","cf_sal_tab_morethan12":"12bulanataulebih","cf_sal_tab_lessthan12":"Kurangdari12bulan","cf_dob_screen_title":"BerapatanggallahirAnda?","cf_dob_field_label":"Masukkantanggal","cf_dob_field_error_msg":"Mohonmaaf!KamitidakdapatmemprosespengajuankreditAndakarenaAndaharusberusia22tahunkeatas","cf_summary_screen_title":"SesuaikannilainyadisinisebelummemintapersetujuandimukamilikAnda","cf_salary_tab_title":"Pendapatanlancar","cf_identity_tab_title":"RUT","cf_dob_tab_title":"Tanggallahir","cf_preview_tab_title":"RingkasankreditAnda","cf_continue_cta_text":"Lanjut","cf_pie_slider_errorMsg":"Harapmasukkannilaiyangvalid","cf_homePe_title":"BelimobilAndadengankredit","cf_homePe_subtitle":"dalam4langkahmudah","cf_homePe_footertTitle":"SimulasikankreditAnda","cf_homePe_footerSubtitle":"dalam4langkahmudah!","cf_homePe_ctaText":"Ya!marikitamulai","cf_approved_status_title":"Selamat!","cf_approved_status_subTitle":"KreditAndatelahdisetujui","cf_carvalue_tab_title":"Nilaiotomatis","cf_carvalue_slider_label":"Nilaimobil","cf_downpayment_tab_title":"Lingkaran","cf_carvalue_screen_title":"Seretuntukmenetapkanhargamobil","cf_downpayment_screen_title":"TentukanberapabanyakyangakanAndaminta","cf_success_title":"IniadalahringkasanpersetujuanAndasebelumnya","cf_modal_description":"Pilihmobilyangingindibayar,masukkandatanya,dankamilangsungmensimulasikankreditAnda","cf_summary_screen_homepe_title":"KapantanggallahirAnda?","cf_salary_screen_homepe_subtitle":"MasukkannilaikuotakustomAndasendiri","cf_modal_success_homepe_subheading":"KreditAndatelahdisetujuidimuka","cf_receive_homepe_preapproval":"MenghitungkreditAndasudahdisetujuisebelumnya","cf_homepe_loading":"MenghitungkreditAndasudahdisetujuisebelumnya","car_value_slider_errorMsg":"Kamimembiayaimobilmulai$1.000.000","cf_pie_slider_homepe_errorMsg":"Andaharusmemasukkanjumlahyanglebihbesardari20%nilaimobil","cf_possible_pending":"PengajuanAndasedangditinjau","cf_identity_homepe_field_error_msg":"MasukkanRUTyangvalid","cf_dob_homepe_field_error_msg":"Mohonmaaf!KamitidakdapatmemprosespengajuankreditAndakarenaAndaharusberusia22tahunkeatas","cf_id_year":"{numberOfMonths}Tahun","cf_id_creditAmout":"TotalHargaKredit","cf_id_period":"Period","cf_poweredBy":"PoweredBy","cf_draft_btn":"Selesaikansekarang","cf_emi_disable_error":"SesuaikanfooteruntukmemilihnilaikuotayangdisesuaikandengananggaranAnda","similarCars":"MobilSerupa","selfInspectionIndiaErrorText":"SayangnyakamitidakdapatmembelimobilAnda.KamimenghargaiAndayangmenjadikankamisebaiopsiuntukmenjualMobil.","unlocking_offer":"MembukaPenawaran","great_work":"KerjaHebat!","selfInspectionSuccessTitle":"TerimakasihtelahmembikandetailmobilAnda.","selfInspectionSuccessSubTitle1":"Ahlihargakamisaatini","selfInspectionSuccessSubTitle2":"membukapenawaranuntukAnda.","selfInspectionSuccessSubheading":"KamitidaksabarbertemudenganAnda","next_step":"Langkahselanjutnya:","selfInspectionIndiaBodyTitlePart1":"KamiakanmenghubungiAndadalambeberapajam","selfInspectionIndiaBodyTitlePart2":"untukmembantumenjualmobilAnda.","selfInspectionIndiaListTitle":"KemudianAndadapatmemilihuntuk:","selfInspectionIndiaListItemTitle1":"PasangIklan","selfInspectionIndiaListItemSubtitle1":"Juallangsungkepembeli","selfInspectionIndiaListItemTitle2":"JualkeOLX","selfInspectionIndiaListItemSubtitle2":"Hargapenawaranterbaik,tanpaperantara","someWhereElse":"Ditempatlain","errorOffline":"Andasepertinyaoffline.HarapperiksakoneksiinternetAnda&cobali.","errorGeneral":"Ups..kamimengalamibeberapakesalahan.Silakancobali!","photoUploadText1":"Cobalah","photoUploadText2":"Menambahkangambardarisemuasisi","photoUploadText3":"mobilAndauntuk","photoUploadText4":"mendapatkannilaiterbaik","errorBoundryMesse":"Ups!Adayangtidakberes,silakancobalinanti","minPriceErrorMesse":"Hargaminimumsemestinya{minValue}","maxPriceErrorMesse":"Hargamaksimumsemestinya{maxValue}","photoUploadDisclaimer":"SilakanunggahfotoMobilaslidanterbaru","headerTitle":"ArahkankeDokumen","emptyPeMesse":"Fiturinitidakdidukungdidesktop.Silakanbukatautandiponsel","testTranslation":"inihanyalahterjemahanpercobaan","cf_preapproval_incomplete":"Selesaikansekarang","cf_preapproval_request_ain":"Buataplikasibaru","cf_modal_rejected_heading":"TerimakasihtelahmengajukanKreditInstanBCAFinancemelaluiOLX. ","cf_zone_heading":"ZonaWilayah","cf_zone_subHeading":"PilihlokasiAnda","cf_insurance_heading":"JenisAsuransi","cf_protection_heading":"PerlindunganMobil","cf_totalDownPayment_heading":"TotalUangMuka","cf_totalDownPayment_subHeading":"UangMuka+PerlindunganMobil+PremiAsuransi+BiayaLainnya","cf_error_screen_title":"Maaf,adagangguanlayanan","cf_error_screen_subtitle":"Jangankhawatir,Andamasihbisalanjutkanpra-persetujuankreditinstan.Cobalisetelahbeberapasaat.","cf_modal_error_heading":"KamimenghitungkreditAnda...","cf_modal_pending_subheading":"BerikutkamisampaikanhasilscoringaplikasikreditAnda.","cf_modal_rejected_subheading":"BerikutkamisampaikanhasilscoringaplikasikreditAnda.","cf_email_messe":"Mohonkirimemailke","locHeading":"DimanamobilAndaberada?","desCompact":"IniakanmembantukamimenemukanlokasiinspeksididekatAnda","desExpanded1":"DenganamandansesuaidenganwaktuAnda","desExpanded2":"SelesaikanpenilaianmobilsesuaiketersediaanAnda","locFooter":"Nilai:INR20.000.Layanangratispertransaksi!","optional":"TidakWajib","paymentDeclined":"PembayaranDitolak!","paymentSuccessful":"PembayaranBerhasil!","reservingCar":"MemesanmobilAnda...","pleaseRetry":"Silakancobali!","retryPayment":"CobaLiPembayaran","reserveSessionExpired":"SesipemesananAndasudahkedaluwarsa!","retryReserving":"Tidakmasalah,Andadapatmencobamemesanmobilli.","youMissed":"Hei,Andabarusajamelewatkannya!","someoneReserved":"Adayangbarusajamemesanmobilitu.Jangankhawatir,kamiakanmemberitahuAndajikamobiltersediakembali.","reserveAnother":"Pesanmobillain","notifyailability":"Beritahusayajikatersedia","reserveCar":"PesanMobil","scheduleAndBook":"JadwalkantestdrivedanpesanmobilAnda","reservationSuccessful":"ReservasiBerhasil!","thanksReserving":"Terimakasihataspesanannya.","proceed":"Pilihcaramelanjutkan","continueBtnLabel":"Lanjutkan","myZoneFeatureText":"LihatdankelolaperjalananAndadiZonaSaya","myZoneSectionHeading":"ZonaSaya","myZoneSectionSubHeading":"LacakperjalananAndadisini","myZoneSectionBuyerText":"Membeli","cf_insuranceQuoteInfo":"Penawarandenganasuransimobiltahunansekitar$12.000MN,jumlahdapatberbedasetelahpersetujuanakhir.","cf_quotationDetailsHeading":"Detailkutipan","cf_quotationDetailsDetails":"Informasiyangdisertakandalamsimulatoriniberisiinformasidanperkiraanvariabel,bukanmerupakanpenawaranyangmengikatdandisediakanhanyauntuktujuaninformasi.Olehkarenaitu,informasiinidapatberubahdandimodifikasisesuaidengankarakteristikdanprofilcalonklien.\u003Cb\u003ECAT42%\u003C\u002Fb\u003E.TanpaPPN.Tanggalperhitunganinformatifper27Juli2021.Sukubungatetap21%pertahuntanpaPPN","testDriveTitle":"Tidakadatestdriveyangdipesan!","reservedTitle":"Tidakadamobilyangdipesan!","shortListedTitle":"Tidakadamobilyangmasukdaftarpilihan!","exploreButtonTitle":"Jelajahisemuamobil","shortListedButtonTitle":"Lihatmobilyangdipilih","badConnectionTitle":"Koneksiburuk","badConnectionErrorMesse":"HarapperiksakoneksiinternetAndadancobali.","somethingErrorMsg":"Ups!Adayangtidakberes.\nSilakancobali.","shortlistContent":"Andaakanmelihatsemuamobilyangdipilihdisini.Ayo,jelajahimobil,kamimemilikibanyakpilihanuntukAnda.","testDriveContent":"AndaakanmelihatsemuabookingtestdriveAndadisini.Ayo,jelajahimobil,kamimemilikibanyakpilihanuntukAnda.","reservedContent":"AndaakanmelihatsemuareservasiAndadisini.Ayo,jelajahimobil,kamimemilikibanyakpilihanuntukAnda.","notifyText":"Beritahusaya","reserveText":"pesan","getStartedText":"Mulai","bookingOptionsText":"Opsipemesanan","complete_address":"AlamatLengkap","hi_input_placeholder":"No.Rumah\u002FNo.Flat","hi_cta_text":"SimpanAlamat&pilihslot","si_cta_text":"TemukanTokodanSlotTerdekat","hi_map_title":"TambahkanAlamatInspeksi","map_info_title":"Teknisiinspeksikamiakantibadititikini","map_info_subtitle":"PindahkanpinkelokasiAndayangtepat","no_store":"InspeksidiStoretidaktersedia.AndadiarahkankeInspeksidiRumah","no_home":"InspeksidiRumahtidaktersedia.AndadiarahkankeInspeksidiStore","SelectInspectionDate":"","SelectInspectionDateSubLabel":"","SelectInspectionTime":"","storeBackIcon":"","homeAddressLabel":""}};if('serviceWorker'innigator){window.addEventListener('load',function(){nigator.serviceWorker.register("/sw.js")});}!function(e,n,t,i,o,r){vara=4e3,c="xnpe_async_hide";functions(e){returne.reduce((function(e,n){returne[n]=function(){e._.push([n.toString(),arguments])},e}),{_:[]})}functionm(e,n,t){vari=t.createElement(n);i.src=e;varo=t.getElementsByTName(n)[0];returno.parentNode.insertBefore(i,o),i}r.target=r.target||"api.exponea.com",r.file_path=r.file_path||r.target+"/js/exponea.min.js",e[t]=s(["anonymize","initialize","identify","update","track","trackLink","trackEnhancedEcommerce","getHtml","showHtml","showBanner","showWebLayer","ping","getAbTest","loadDependency","getRecommendation","reloadWebLayers"]),e[t].notifications=s(["isailable","isSubscribed","subscribe","unsubscribe"]),e[t].snippetVersion="v2.1.0",function(e,n,t){e[n]["_"+t]={},e[n]["_"+t].nowFn=e[t]&&e[t].now?e[t].now.bind(e[t]):Date.now,e[n]["_"+t].snippetStartTime=e[n]["_"+t].nowFn()}(e,t,"performance"),function(e,n,t,i,o,r){e[o]={sdk:e[i],sdkObjectName:i,skipExperiments:!!t.new_experiments,sign:t.token+"/"+(r.exec(n.cookie)||["","new"])[1],path:t.target}}(e,n,r,t,o,RegExp("__exponea_etc__"+"=([\\w-]+)")),function(e,n,t){m(e.file_path,n,t)}(r,i,n),function(e,n,t,i,o,r,s){if(e.new_experiments){!0===e.new_experiments&&(e.new_experiments={});varp=e.new_experiments.hide_class||c,u=e.new_experiments.timeout||a,_=encodeURIComponent(r.location.href.split("#")[0]),l=e.target+"/webxp/"+n+"/"+r[t].sign+"/modifications.min.js?="+_+"&timeout="+u+"ms";"sync"===e.new_experiments.mode&&r.localStore.getItem("__exponea__sync_modifications__")?function(e,n,t,i,o){t[o][n]="",i.writeln(t[o][n]),i.writeln("!"+o+".init&&document.writeln("+o+"."+n+'.replace("/'+n+'/","/'+n+'-async/").replace(">")}(l,n,r,s,t):function(e,n,t,i,o,r,a,c){r.documentElement.classList.add(e);vars=m(t,i,r);functionp(){o[c].init||m(t.replace("/"+i+"/","/"+i+"-async/"),i,r)}functionu(){r.documentElement.classList.remove(e)}s.onload=p,s.onerror=p,o.setTimeout(u,n),o[a]._revealPe=u}(p,u,l,n,r,s,o,t)}}(r,i,o,0,t,e,n),function(e,n,t){e[n].start=function(i){i&&Object.keys(i).forEach((function(e){returnt[e]=i[e]})),e[n].initialize(t)}}(e,t,r)}(window,document,"exponea","script","webxpClient",{target:"fcg-api.exponea.com",token:"2c4f2de8-9170-11e8-8823-0a580a201a47",});exponea.start({ping:{properties:{sending_system:'Panamera-frontend'}}});

Posto:OLX Pusatnya Nge-Dealrapporto

In caso di violazione del sito, fare clic su Segnalarapporto

Informazioni consigliate

Sito consigliato