| mbsnews.id

  • 2022-01-06Data di raccolta
  • 2022-02-15Aggiornato
 | mbsnews.id
  • Indirizzo Web:www.mbsnews.id
  • IP del server:104.26.2.219
  • Descrizione del sito:

nome del dominio:www.mbsnews.idValutazione

di 500~20000

nome del dominio:www.mbsnews.idflusso

289

nome del dominio:www.mbsnews.idBene o male

Fama e ricchezza. Prosperità e ricchezza Ji

sito web: | mbsnews.idPesi

3

sito web: | mbsnews.idIP

104.26.2.219

sito web: | mbsnews.idsoddisfare

|mbsnews.id @media(min-width:768px){.d-iklan-none{display:none!important;}.d-md-iklan{display:none!important;}}@media(min-width:992px){.d-iklan-none{display:none!important;}.d-lg-iklan{display:inline!important;}}@media(min-width:1200px){.d-iklan-none{display:none!important;}.d-xl-iklan{display:inline!important;}} _atrk_opts={atrk_acct:"z3YQt1kx0820/9",domain:"mbsnews.id",dynamic:true};(function(){varas=document.createElement('script');as.type='text/jascript';as.async=true;as.src="certify-js.alexametrics.com/atrk.js";vars=document.getElementsByTName('script')[0];s.parentNode.insertBefore(as,s);})();HomeNewsPolitikNusantaraHukumEkonomiLifestyleOlahraPolriIndexRaffiAhmadCurhatSoalWaktunyaBersamaRaffatharSemakinSedikit,JadiJarangPergiBersamaRabu,29Juni2022-14:23WIBMunculWacanaLegalkanGanjaMedis,DPRDorongKajianIlmiahDimulaiRabu,29Juni2022-14:15WIBRangkaianHUTBhayangkarake-76,KapolresMuaroJambiPimpinTaburBungadiTMPBukitKusumaBaktiRabu,29Juni2022-13:55WIBKasusKSPIndosurya:BuruTersangkaSuwitoAyub,BareskrimPolriTerbitkanRedNotice!Rabu,29Juni2022-13:41WIBHolywingsBisaBeroperasiLi,SyaratnyaHarusPenuhiKetentuandariPemprovDKIJakarta!Rabu,29Juni2022-13:30WIBHamishDaudDimintaPilihRaisaJadiIbuRumahTanggaAtauPenyanyi,BeriJawabanSepertiIniRabu,29Juni2022-12:30WIB"Penginbangetpunyastablehome,"ujarHamish...•TerusDituntut,KPKPastikanTidakHanyaKejarBuronanHarunMasiku Rabu,29Juni2022-12:15WIBHarunMasikuselamalebihdari900hari,padaSelasa,28Juni2022....•KemendBersiapGelarPameranDangInternasionalTerbesardiIndonesiaSecaraHibridaRabu,29Juni2022-11:55WIBTradeExpoIndonesiayang diselenggarakan tahun ini merupakan kesempatan yang sangat baikbi para pelaku usaha Indonesia untuk memper...•PolisiSelidikiDugaanKelalainTerkaitJebolnyaTandonAirProyekLRTKuninganRabu,29Juni2022-11:41WIBKitasedangselidikidugaankelalaiannyasampaibisajebol...•Wamenkum-HAMPastikan,takAkanHapusPasalPenghinaanPresidendiRKUHP!Rabu,29Juni2022-11:30WIBEddymengatakan,pihak-pihakyangmenyebutpasalitusebaisikapantikritikadalahorang-orangyangsesatberpikir...•NovartisRencanakanPHK8RibuPekerjaSecaraGlobalRabu,29Juni2022-11:02WIBMahalnyaharga-hargamembuatpukulanbiindustri,termasukfarmasi.Ujung-ujungnyaPHKtakterelakan....•MayangSebutAkanKuliahdiFakultasKedokteranGigiUniversitasMoestopo,DoddySudrajatBeriPesanBijakRabu,29Juni2022-10:30WIB"Soalnyakanakujugasebenernyasifatdasarakutuhintrovert,"ujarMayang...•JanjiUsutTuntasKorupsidiIndosurya,BareskrimMintaSemuaKorbanBikinLaporanRabu,29Juni2022-10:15WIBPihaknyaakanmemecahsemualaporanpolisiyangtelahdijadikansatu....•GelarFestivalNusantaraGemilang,Kapolri:PesanMoralPentingnyaJaPersatuan-KesatuanRabu,29Juni2022-09:55WIBFestivaliniadalahbuktibahwaIndonesiamerupakannegarayangmemilikikeberamaandankekayaansenibudaya....•KutukSadioManePindahkeBayernMunchen,DeanSaundersDisebutIdiotolehCEOBorussiaDortmund!Rabu,29Juni2022-09:30WIBMengetahuikomentarkontroversialitubosDortmundWatzkegeram.WatzketidaksungkanmenyebutDeanSaunderssebaisosokyangidiotdanarogan...•DianggapMerendahkanAnggaWijayaSebaiSuami,NetizenDukungGugatanCeraiTerhadapDewiPerssikRabu,29Juni2022-08:35WIB"Gak,gakberikansemangat,diamakan,"bantahDewi...•DemiMisiPerdamaianRusiadanUkraina,PresidenJokowiRelaNaikKereta12JamRabu,29Juni2022-08:15WIBPresidenJokowiselalumengeceksetiapdetailkegiatanyangdilakukan....•Tahun2021,AdhiCommuterMulaiUnjukGigi,BikanDividenRp26MiliarRabu,29Juni2022-08:02WIBTahunlalu,bisnispropertimulaimenunjukangiginya.SetelahsempattiaraplantaranpandemiCOVID-19....•KemenkoPerekonomianGoestoCampus,Lebihdari500AudiensAntusiasBahasAksesPermodalanUMKMRabu,29Juni2022-07:55WIBPemerintahmendorongmahasiswamemanfaatkanKURuntukpembiayaanusahaardapatmemulaiataumengembangkanusahanya,sehinggamenghasilkanprodukde...•SunnyTanuwidjajaMundurdariPSI!KarenaDukungAnies?Rabu,29Juni2022-07:30WIBNamaSunnyTanuwidjajasempatmendapatsorotanpada2018lalu.IadiketahuipernahmenjadistafkhususBasukiTjahajaPurnama(BTP)aliasAhoksaatma...•TheFedKerekSukuBungaLi,ResesiMakinDekatRabu,29Juni2022-07:21WIBPembuatkebijakanFederalReserve,Selasa(28/6/2022)menjanjikankenaikansukubungalanjutanuntukmenurunkaninflasitinggi....•AdamDeniDihukumPenjara4Tahun,TakTerimadanSebutVonisHakimSesuaiPesananRabu,29Juni2022-06:30WIB"Perasaansayabiasaaja,tidakadarasagemetarataubaimana,"kataAdamDeni...•SriMulyaniUngkapKontribusiKehutananTerhadapEkonomiHanya0,6persenRabu,29Juni2022-05:55WIBKontribusidarisektorkehutanandanpenebangankayu,terutamadiukurdenganPDB(ProdukDomestikBruto),dalamhalinikontribusinyaRp91triliunhin...•PenjaraTuluadiKolombiaKebakaran,51NapiTewasTerpanggang!Rabu,29Juni2022-05:30WIBPenjarainidiketahuimemilikitotal1.267narapidana.Kebakaranmenghanguskan180kamartahanan.DiKolombia,sepertidibanyaknegaraAmerikaLatin,...•MenakerIdaFauziyahLepas150PerawatProfesionalkeArabSaudiRabu,29Juni2022-04:34WIBJumlahlulusanperawatdariperguruantinggikesehatanataukeperawatanmencapai70.000-anpertahun.Sementaradarijumlahtersebut,lebihdariseparu...•Wapres:TingkatkanInvestasi,PercepatKehadiranMalPelayananPublikRabu,29Juni2022-04:04WIBTahun2024ditargetkanseluruhkab/kotatelahmenghadirkanMPP.Selainkuantitatif,kualitasMPPjugaperludiperhatikandenganterusdievaluasidari...•KarbonBiruJadiStrategiMitigasiBencanadiIndonesiaRabu,29Juni2022-03:33WIBKarbonbiru,sebaisalahsatujasaekosistempesisir,berperanpentingdalamimplementasikebijakanekonomibiru...•MemasukiLiburSekolah,MenparekrafRekomendasikanDestinasiWisataUnggulandiIndonesiaRabu,29Juni2022-03:03WIBLibursekolahmenjadimomentumpenggerakekonomimasyarakatdenganterbukanyapeluangusahadanlapangankerja...•PresidenJokowiLanjutkanKunjunganKerjakeUkrainaMelaluiPolandiaRabu,29Juni2022-02:32WIBPengaturanendakunjunganPresidenJokowidanIbuIrianaJokowibesertarombonganterbataskeUkrainatentunyasudahdipersiapkansangatmatang,nam...•MenhanPrabowoApresiasiCapaianKemhan/TNIRaihPredikatWTPEmpatKaliBerturut-turutRabu,29Juni2022-02:02WIBMenhanPrabowomenekankankepadaparakasatker,kasubsatkerdilingkunganKemhandanTNIarmenindaklanjutirekomendasiyangadadalamsetiaplapora...•WamenkumhamTekankanPentingnyaPengelolaanAsetBMNUntukMemberikanLayananOptimalBiMasyarakatRabu,29Juni2022-01:01WIBMariteguhkanhatidanpikiranuntukdapatmenjaamanahyangdiberikankepadakita.Pahamitugasdanfungsimasing-masingardapatmengelolaaset...•BatalPanen,LadangGanja10HektarediLerengGunungKaruhunDigerebekPolisi!Selasa,28Juni2022-23:41WIBpenggerebekanladangganjatersebutsetelahpetugasmendapatlaporandariwarga....•PemerintahDiingatkanPenggunaanPeduliLindungiBerpotensiBikinKegaduhanSelasa,28Juni2022-23:15WIBMerepotkanmasyarakatsertaberpotensimenyebabkanpenyimpangan. ...•HubunganPutriDelinadanNathalieHolscherMemanas,RizkyFebianUngkapKerinduanKepadaMendiangSangMamaSelasa,28Juni2022-22:20WIBRizkyFebianmeluapkanrasarindunyakepadaLinaJubaedah."Aakangenmama,"kataRizkyFebian....•DuaPetinggiKementerianPerindustrianDiperiksaKejungTerkaitKorupsiImporBajaSelasa,28Juni2022-22:15WIBImporbesiataubaja,bajapaduan,danprodukturunannyatahun2016-2021. ...•KotaTangerangjadiPilotProjectKeamananInformasiBSSNSelasa,28Juni2022-21:55WIBDenganhadirnyaruanganini,berartisemuaIPA(IntelligentProcessAutomation)yangtergabungdalamsatudashboard.Sepertiinformasiyangbersifatu...•MalaysiaOpen2022:KalahkanPemainPeringkatSatuDuniaAkaneYamuchi,GregoriaLoloske16Besar!Selasa,28Juni2022-21:41WIBBerladiAxiataArena,pebulutangkisperingkatke-31menangduagimlangsung21-14,21-14....•HolywingsDidugaLakukanPenistaanama,HotmanParisMintaMaaf,KetuaMUI:Dimaafkan,TapiProsesHukumBerjalan!Selasa,28Juni2022-21:20WIB"HalosayaHotmanParisselakupemegang | mbsnews.idsahamdiHolywingsdatangbersilaturahmikerumahbapakKiaiCholilNafisselakuKetuaMUIdanRaisSyuriahda...•PolriRaihWTPSembilanKaliBerturut-turut,Kapolri:KomitmenPenggunaanKeuanganNegaraSecaraTransparanSelasa,28Juni2022-20:30WIBPolriakanterusberkomitmenuntukmelaksanakanseluruhrekomendasiyangdiberikanolehBPKRIsebaibentukpertanggungjawabansebaimanadalamatu...•AnggaWijayaGugatCerai,DewiPerssikPasrah:CeraiNggakApa-Apa,MauKembaliNggakApa-ApaSelasa,28Juni2022-20:20WIB"Nggaktahujuga.Akujuganggakngerti.Jangantanyaaku.Aku,khan,yangdigugat,"ujarDewiPerssik....•SelangkahLi,3ProvinsiBarudiPapuaBakalDisahkanSelasa,28Juni2022-20:15WIBUntukpengambilankeputusantingkatIIatautahappengesahan....•CitilinkSasarSegmenPenerbanganMurahSelasa,28Juni2022-20:03WIBCitilinkIndonesiabakalmengembangkansegmenpenerbanganberbiayahematataulowcostcarrier(LCC)....•PemkotSurabaya'Bekukan'3OutletHolywingsSelasa,28Juni2022-19:55WIBTidakdicabut,tapidibekukan,nggakbolehbukadulusampaikasusnyatuntas.Kotainimenjunjungtingginilaitoleransiantarumatberama,kalauada...•JatanrasPoldaJatimBantuPenyelidikanKasusPenembakanolehOTKdiSidoarjoSelasa,28Juni2022-19:41WIBSedangkanpelakupenembakanmerupakanorangyangtidakdikenalatauOTK....•UjiCobaBeliPertalitePakaiMyPertaminaBerlakudi5Provinsi,IniDaftarnyaSelasa,28Juni2022-19:29WIBMasyarakatyangberhakmenggunakanPertalitedanSolardapatmendaftarkandatanyamelaluisitusSubsiditepat.mypertamina.idbilatidakmemilikiaplika...•PolisiSegeraUmumkanStatusRoySuryodalamKasusMemeStupaBorobudurMiripPresidenJokowiSelasa,28Juni2022-18:41WIBdualaporanlainnya,terkaitunggahanmemePatungSangBudhaolehRoySuryodiakunmediasosialpribadinya...•KesengsemKetenanganSangKakek,JefriNicholTatoNamanyadiTubuh:OrangnyaSabarBanget,Sumpah!Selasa,28Juni2022-18:20WIB"Guepenginmenghabiskanwaktusamakakekgua.Udahnggakada.Guejarangketemukakekdarinyokap,"terangJefriNichol....•SorotiPelayananPublik,WapresMarufMintaPengurusanAkteLahirDipermudahSelasa,28Juni2022-18:15WIBStrategispemerintahdalammewujudkansalahsatuvisiIndonesiaMaju. ...•PolriTegaskanKasusPenipuanInvestasiKSPIndosuryaTetapBerjalanMeskiMasaTahananTersangkaSelesaiSelasa,28Juni2022-17:55WIBPolripuntelahmelakukanpenyitaanterhadapbarangbuktidanasetyangdidugasebaihasilkejahatansenilaiRp.2,178triliun.Totalkeseluruhanin...•EmirsyahSatarKembaliDitetapkanTersangkaKorupsiPengadaandanSewaPesawatGarudaIndonesiaSelasa,28Juni2022-17:30WIBJaksaungSTBurhanuddinmenegaskan,penetapanduatersangkat | mbsnews.idersebut,adalahkelanjutandaripenyidikankasusyangmerugikannegarasenilaiRp8,8...•Menpora:PisahkanPolitikdariSepakBola,TimnasIsraelBolehBermaindiPialaDuniaU20!Selasa,28Juni2022-16:41WIBFIFAsudahmenyampaikankepadakami,negaramanapunyangmasukkePialaDuniaU-202023,harusbertandingdiIndonesia...•TampikKontroversi,MayangUngkapKuliahdiFakultasKedokteran,Netizen:NggakUsahJadiArtis!Selasa,28Juni2022-16:20WIB"UdahketerimadiUniversitasMoestopo,"jelasMayang."Jurusan?"tanyapewawancara."FKG(FakultasKedokteranGigi),"jawabMayang....•GandengKejung,AksiErickThohirBersihkanKorupsidiBUMNDiapresiasiSelasa,28Juni2022-16:15WIBUpayamembersihkandanmenyehatkanBUMNdanpraktikkorupsi....•Polisi BongkarKasusSkimmingBankBUMNOlehWNAAsalEstoniaSelasa,28Juni2022-15:55WIBKeuntunganyangdiperolehberdasarkanpemeriksaanhinggasaatinisebesar$900sampaidengan$1050...•TakPerluResah,PerubahanAlamatdiSTNKPemilikKendaraanDilakukanSaatBayarPajakLimaTahunanSelasa,28Juni2022-15:41WIBhalitudilakukanarmasyarakatpemilikkendaraantakterbebanidenganperubahannamajalantersebut....•YourbrowserdoesnotsupportHTMLvideo.Populer .h7{ font-size:2px; } BikinHeboh!DoddySudrajatSalahUcapS... .h7{ font-size:2px; } TepisTuduhanSelingkuh,SaipulJamilHa... .h7{ font-size:2px; } SosialisasiBeliMigorCurahPakaiPedul... .h7{ font-size:2px; } KejarIdulAdha,KementanTargetkan800... .h7{ font-size:2px; } APTRISebutPabrikGulaMilikBUMNBanya....header-cardxx{position:fixed;/*fixedisabsolutetoabrowser*/ z-index:4;bottom:0; align-content:center;left:0;right:0; height:50px; width:375px;/*background:rgba(0,0,0,0.5);color:white;*/}(adsbygoogle=window.adsbygoogle||[]).push({});Redaksi|Desclimer|PedomanPemberitaanMediaSiber|MediaPartner‘MBSNews169; 'MBSNews.AllRightsReservedwindow.dataLayer=window.dataLayer||[];functiongt(){dataLayer.push(arguments);}gt('js',newDate());gt('c | mbsnews.idonfig','UA-0-1');

Posto: | mbsnews.idrapporto

In caso di violazione del sito, fare clic su Segnalarapporto

Informazioni consigliate

Sito consigliato