Home | Daily Mail Online

  • 2022-01-06Data di raccolta
  • 2022-02-15Aggiornato
Home | Daily Mail Online
  • Indirizzo Web:dailymail.co.uk
  • IP del server:23.62.176.178
  • Descrizione del sito:

nome del dominio:dailymail.co.ukValutazione

di 5000~500000

nome del dominio:dailymail.co.ukflusso

310

nome del dominio:dailymail.co.ukBene o male

Grande risultato. deve essere prospero di buon auspicio

sito web:Home | Daily Mail OnlinePesi

2

sito web:Home | Daily Mail OnlineIP

23.62.176.178

sito web:Home | Daily Mail Onlinesoddisfare

try{Object.defineProperty(window,'adverts',{configurable:false,value:{}});}catch(error){console.error(error);}Home|DailyMailOnline vardisableAds=false;PeCriteria=window.PeCriteria||{};PeCriteria.clientIP='110.111.97.227';PeCriteria.nonAdservable=''==='true';PeCriteria.device='other';PeCriteria.liveCommentary=false;/*/static/mol-fe/static/mol-fe-sync-bundle/6.12.0-pr-319.2216/placeholder/desktopChannel.css*/#pe-container.pe-header.n-primary{font-size:1.5em;font-weight:bold;border-bottom:none;padding:3px00;background:url(/i/furniture/structure/nigation_bottom.gif)repeat-x0100%;position:relative;height:28px}#pe-container.pe-header.n-primaryli{float:left}#pe-container.pe-header.n-primaryli.first{border-left:none}#pe-container.pe-header.n-primarya{display:block;padding:4px7px7px;text-decoration:none;_float:left}#pe-container.pe-header.n-primary.link-gr6oxa,#pe-container.pe-header.n-primary.link-ccoxa,#pe-container.pe-header.n-primary.linkro-ccoxa{margin:4px07px;padding:07px06px;border-left:1pxsolid#000}#pe-container.pe-header.n-primary[data-on-hover-menu]{display:none;position:absolute;top:31px;left:0;width:100%;z-index:}#pe-container.pe-header.n-primary[data-on-hover-menu].n-secondary{font-size:12px;border:none}#pe-container.pe-header.n-primary[data-on-hover-menu].n-secondaryulli{padding:06px}#pe-container.pe-header.n-primary[data-on-hover-menu].n-secondaryullia{padding:0}#pe-container.pe-header.n-primary>li>span.selected>a{border-top-right-radius:5px;border-top-left-radius:5px}#pe-container.pe-header.n-secondary{font-size:1.2em;font-weight:bold;padding:7px00;border-top:none;border-bottom:none}#pe-container.pe-header.n-secondaryli{float:left;border-left:1pxsolid#fff;padding:06px;margin-bottom:7px}#pe-container.pe-header.n-secondaryli.first{border-left:none}#pe-container.pe-header.n-secondarylia.current{font-style:italic}#pe-container.pe-header.n-secondarylia:hover{text-decoration:underline}#pe-container.pe-header.border-top{border-top:1pxsolid#c0c0c0}#pe-container.pe-header.debate>.n-secondaryullia{color:#}#pe-container.pe-header.new.n-secondary{font-size:1.3em}.homecontactus#pe-container.pe-header.n-secondaryulli,.homebooks#pe-container.pe-header.n-secondaryulli,.homeyou#pe-container.pe-header.n-secondaryulli,.homelatest#pe-container.pe-header.n-secondaryulli,.homepromotions#pe-container.pe-header.n-secondaryulli,.homeproperty#pe-container.pe-header.n-secondaryulli,.homegardening#pe-container.pe-header.n-secondaryulli,.homehome#pe-container.pe-header.n-secondaryulli,.auhomeauhome#pe-container.pe-header.n-secondaryulli{padding:05px}.facebook-like-static{margin-left:5px;width:76px;height:20px;cursor:pointer}.facebook-like-staticimg{height:20px}.article.breaking-newsh2a::before,.article-preview.breaking-newsh2::before,.article.exclusiveh2a::before,.article-preview.exclusiveh2::before{display:inline-block;background:#f;color:#fff;line-height:28px;height:28px;padding:1px6px0;margin-right:8px;font-size:24px;position:relative;top:-2px;white-space:nowrap;font-family:arial,sans-serif}.article.breaking-newsh2a::before,.article-preview.breaking-newsh2::before{content:"BREAKINGNEWS"}.article.exclusiveh2a::before,.article-preview.exclusiveh2::before{content:"EXCLUSIVE"}.column-split.article.article-topstory.breaking-newsh2a::before,.column-split.article.article-topstory.exclusiveh2a::before,.column-split.article.article-large.breaking-newsh2a::before,.column-split.article.article-large.exclusiveh2a::before,.beta.article.article-topstory.breaking-newsh2a::before,.beta.article.article-topstory.exclusiveh2a::before,.beta.article.article-large.breaking-newsh2a::before,.beta.article.article-large.exclusiveh2a::before{font-size:20px;top:-4px;height:24px;line-height:24px}.column-split.article.article-small.breaking-newsh2a::before,.column-split.article.article-small.exclusiveh2a::before,.column-split.article.article-smallslant.breaking-newsh2a::before,.column-split.article.article-smallslant.exclusiveh2a::before,.beta.article.article-small.breaking-newsh2a::before,.beta.article.article-small.exclusiveh2a::before,.beta.article.article-smallslant.breaking-newsh2a::before,.beta.article.article-smallslant.exclusiveh2a::before{line-height:16px;height:16px;margin-right:4px;font-size:12px;padding:04px;top:-2px}.mol-mobile.article-preview.breaking-newsh2::before,.mol-mobile.article-preview.exclusiveh2::before{line-height:23px;height:24px;font-size:16px;font-family:system-ui,-apple-system,sans-serif}.mol-desktop.android.article.article-tri-headline.breaking-newsh2a::before,.mol-desktop.android.article.article-tri-headline.exclusiveh2a::before{display:inline}@-webkit-keyframesmol-live-pulse{0%{opacity:1}50%{opacity:0.3}to{opacity:1}}@keyframesmol-live-pulse{0%{opacity:1}50%{opacity:0.3}to{opacity:1}}.mol-live-pulse{top:-5px;display:inline-block;background-color:#f;color:#fff;height:29px;font-size:20px;font-weight:bold;position:relative;white-space:nowrap;font-family:arial,sans-serif;padding:06px;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none}.mol-live-pulse.mol-live-bullet-text{line-height:29px;vertical-align:middle}.mol-live-pulse.mol-bullet-icon{background:-o-radial-gradient(circle,transparent53%,rgba(187,25,25,0.5)53.5%,#fff60%);background:radial-gradient(circle,transparent53%,rgba(187,25,25,0.5)53.5%,#fff60%);position:relative;border-radius:50%;height:16px;width:16px;display:inline-block;vertical-align:middle;margin-right:-3px}.mol-live-pulse.mol-bullet-icon::before{background:-o-radial-gradient(circle,#fff37%,rgba(187,25,25,0.5)37.5%,transparent38%);background:radial-gradient(circle,#fff37%,rgba(187,25,25,0.5)37.5%,transparent38%);content:"";position:absolute;width:100%;height:100%;border-radius:50%;-webkit-animation:mol-live-pulse1.7seaseinfinite;animation:mol-live-pulse1.7seaseinfinite;left:0}.alpha.article.exclusive.mol-live-pulse{top:-6px}.alpha.article-small.exclusive.mol-live-pulse,.article-small.mol-live-pulse,.article-smallslant.mol-live-pulse{top:-3px;height:16px;font-size:12px}.alpha.article-small.exclusive.mol-live-pulse.mol-bullet-icon,.article-small.mol-live-pulse.mol-bullet-icon,.article-smallslant.mol-live-pulse.mol-bullet-icon{height:9px;width:9px;margin-right:-1px}.alpha.article-small.exclusive.mol-live-pulse.mol-live-bullet-text,.article-small.mol-live-pulse.mol-live-bullet-text,.article-smallslant.mol-live-pulse.mol-live-bullet-text{line-height:16px}.mol-mobile.mol-live-pulse{top:-2px;height:24px;font-size:19px;line-height:22px}.mol-mobile.mol-live-pulse.mol-live-bullet-text{line-height:24px}.article-pe.mol-mobile.mol-live-pulse{top:-1px;height:26px;font-size:20px;line-height:22px;margin-right:2px}.article-pe.mol-mobile.mol-live-pulse.mol-live-bullet-text{line-height:26px}.article-text.mol-live-pulse{top:4px;height:30px;font-size:22px;position:absolute}.article-text.mol-live-pulse.mol-bullet-icon{margin-right:4px}.article-text.mol-live-pulse.mol-live-bullet-text{line-height:30px}.article-text.mol-live-pulse+h2::before,.article-text.mol-live-pulse+h1::before{content:"";display:inline-block;width:90px}.puffulli.mol-live-pulse{top:-2px;height:16px;font-size:11px;padding:03px;margin-right:1px}.puffulli.mol-live-pulse.mol-bullet-icon{height:9px;width:9px;margin-right:2px}.puffulli.mol-live-pulse.mol-live-bullet-text{line-height:16px}.puffulli.exclusive.mol-live-pulse{top:-1px}.article.mol-live-pulse+h2,.article-text.mol-live-pulse+h2{display:inline}.cc-article-body.article-text.mol-live-pulse{top:24px}.cc-channel-editor.mol-live-pulse{margin-right:8px}.cc-channel-editor.column-split.article.article-small.mol-live-pulse,.cc-channel-editor.column-split.article.article-smallslant.mol-live-pulse,.cc-channel-editor.beta.article.article-small.mol-live-pulse,.cc-channel-editor.beta.article.article-smallslant.mol-live-pulse{margin-right:4px}html{color:#000;background:#fff;font-size:100%}body{line-height:auto;font-size:62.5%;margin:0;font-family:Arial,Helvetica,sans-serif;*text-align:center}body,div,dl,dt,dd,ul,ol,h1,h2,h3,h4,h5,h6,pre,code,form,fieldset,legend,input,textarea,p,blockquote,th,td,a{margin:0;padding:0;min-height:1px;_height:1px}table{border-collapse:collapse;border-spacing:0;font-size:100%}img{margin:0;padding:0}fieldset,img{border:0}address,caption,cite,code,dfn,th,var{font-style:normal;font-weight:normal}li{padding:0;margin:0;list-style:none}caption,th{text-align:left}h1,h2,h3,h4,h5,h6,pre,code{font-size:1em}q::before,q::after{content:""}abbr,acronym{border:0;font-variant:normal}sup{vertical-align:text-top}sub{vertical-align:text-bottom}input,textarea,select,button{font-family:Arial,Helvetica,sans-serif;font-size:inherit;font-weight:inherit}input,textarea,select{*font-size:100%}legend{color:#000}a{text-decoration:none;cursor:pointer}h2{font-weight:bold}.ext-strict.js-hide{display:none}a{color:#}.cleared::after,.pe::after{content:".";display:block;line-height:0;font-size:0;height:0;clear:both;visibility:hidden}.cleared{min-height:1px;_height:1px}.clear{clear:both;width:auto;min-height:0!important;height:0!important;line-height:0!important;font-size:0!important;float:none!important;padding:0!important;border:0!important}br.cleared{clear:both;line-height:0;margin:0;padding:0}textarea{font-family:Arial;font-size:12px;padding:1px2px}.float-l{float:left}.float-r{float:right}.align-l{text-align:left}.align-c{text-align:center}.align-r{text-align:right}.align-b{vertical-align:bottom}.relative{position:relative}.static{position:static!important}.block{display:block}.usability{left:-px;position:absolute;text-align:left;width:1px;height:1px;overflow:hidden}.item{font-size:1.2em;margin-bottom:15px;position:relative}.item.item{font-size:1em;margin-bottom:0}#content.item.bottom{margin-bottom:0}.pe{position:relative;margin:0auto;width:964px}.header{position:relative}p.stanFont,.stanFontp{font-size:1.2em;padding:4px0}.two-em{font-size:2em}.three-em{font-size:3em}.generich1{font-size:2.2em}.generich2{font-size:1.4em;padding-top:10px}.generich3{font-size:1.2em;font-weight:bold}.bold{font-weight:bold}.no-border{border:none!important}.nowrap{white-space:nowrap}.noselect{-webkit-touch-callout:none;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none}.pl20{padding-left:20px}.pad5{padding:5px}.pad10{padding:10px}.bot10{margin-bottom:10px}.bot15{margin-bottom:15px}.rgt320{margin-right:320px}.femail.femail-text:not(.carouselstrapline),.royal_wedding.femail-text{font-family:TimesNewRoman}ul.inblocks{word-spacing:-1em;letter-spacing:-1em}ul.inblocksli{display:-moz-inline-stack;display:inline-block;word-spacing:normal;letter-spacing:normal;vertical-align:top;zoom:1}a.btn-grey{display:block;text-align:center;width:6em;font-size:1em;float:left;margin-left:3px}.btn-grey,.btn-grey-small{font-weight:bold;font-size:1.2em;padding:03px;cursor:pointer;background:transparenturl(/i/furniture/articles/button_bg.gif)repeat-x00;*width:6em}.btn-grey-small{*width:3.5em}.btn-grey.arrow-small-r,.btn-grey-small.arrow-small-r{float:right;margin-left:3px}.btn-grey.arrow-small-l,.btn-grey-small.arrow-small-l{margin-right:3px}.ime-wrap{position:relative}.bdrgr3{border:1pxsolidsilver}.pe{width:964px;margin:0auto;text-align:left}.beta-only{width:auto!important}html,body{overflow-x:visible}.pe{overflow-x:hidden}@media(min-width:965px){html,body{overflow-x:hidden}.pe{overflow-x:visible}}#pe-container{position:relative}.pe-banner-sbb{padding-top:185px}#content{position:relative}div.pe-header{border-right:none;border-bottom:none;border-left:none;position:relative;margin:2.5em08px}.headeronlydiv.pe-header{margin-bottom:0}.no-top,.no-topdiv.pe-header{margin-top:0.5em}.masthead{height:91px;background-position:100%;background-repeat:no-repeat;position:relative}.mastheadimg#logo{position:absolute;top:7px;left:0}.h1-pe-last-updated{position:absolute;top:99px;left:0;font-size:1.2em}.h1-pe-last-updated>span,.h1-pe-last-updatedh1{float:left;margin-right:3px}.masthead.banner{width:468px;height:60px;position:absolute;right:0;top:15px}.masthead-map{display:none;float:right;height:91px;position:absolute;right:0;top:0;width:597px;z-index:1}.pe-header.supplements,.pe-header.weather{position:absolute;top:-1.8em;left:0;font-size:1.3em;width:700px;z-index:2;-webkit-text-size-adjust:none}.pe-header.supplementsa{padding:04px01px;color:#000;font-weight:bold}.pe-header.supplements.lkeFlwdiv{padding-left:5px;float:left}.pe-header.supplements.lkeFlw.pinterest-follow-button{padding-left:0;padding-right:0}.pe-header.supplements.lkeFlw.pinterest-follow-buttona{display:none;margin-left:5px!important;margin-right:3px!important}.pe-header.supplements.links{padding-top:2px}#content.articlePe{min-height:800px;_height:800px}.alpha{width:636px;margin-right:20px;float:left;_display:inline}.beta-only.alpha{width:auto;margin:0}.beta,.column-split{width:308px;float:left}.beta-only.beta{float:none}.lead-beta.alpha{margin-right:0}.lead-beta.beta{margin-right:20px}.column-splitter.first-column{margin-right:20px;_display:inline}.column-splitter::after,.gamma::after{content:".";display:block;line-height:0;font-size:0;height:0;clear:both;visibility:hidden}.column-splitter{min-height:1px;_height:1px}.pe-footer{text-align:center;font-size:1.1em}.pe-footera,.pe-header.supplementsa{display:inline;border-right:1pxsolidblack;padding:04px01px}.pe-footera:hover,.pe-header.supplementsa:hover{text-decoration:underline}.pe-footera.last,.pe-header.supplementsa.last{border-right:none}.pe-footer.companya{border:none;padding:0}.line-break{margin-top:10px;border-left:none!important;border-right:none!important;border-bottom:none!impHome | Daily Mail Onlineortant}body.mol-feature.mol-desktop.pe-header{width:964px;margin-left:auto;margin-right:auto;text-align:left}div.article-icon-links-container{clear:both}div.article-icon-links-containerul.article-icon-linksli{padding:05px03px;float:left;list-style-type:none;white-space:nowrap}div.article-icon-links-containerul.article-icon-linksli.first{margin:0;padding-left:0}div.article-icon-links-containerul.article-icon-linkslia{color:black;line-height:16px;position:relative;padding-right:2px;_padding-right:1px;display:block;_display:inline;z-index:10}div.article-icon-links-containerul.article-icon-linkslia:hover{text-decoration:none;_text-decoration:underline;color:black}div.article-icon-links-containerul.article-icon-linkslia.icon{position:absolute;margin-top:2px;left:0;height:13px;width:18px}div.article-icon-links-containerul.article-icon-linkslia.addstories-link.icon,div.article-icon-links-containerul.article-icon-linkslia.removestories-link.icon{width:12px}@mediaonlyscreenand(min-device-width:768px)and(max-device-width:1024px)and(orientation:portrait){div.article-icon-links-containerul.article-icon-linksli{padding-right:2px}div.article-icon-links-containerul.article-icon-linksli:last-child{padding-right:0}}div.article-icon-links-containerul.article-icon-linkslia.comments-link.icon{width:14px}div.article-icon-links-containerul.article-icon-linkslia.videos-link.icon{background-position:-98px0}div.article-icon-links-containerul.article-icon-linkslia.linktext{padding-left:22px}div.article-icon-links-containerul.article-icon-linkslia.videos-link.linktext{padding-left:26px}div.article-icon-links-containerul.article-icon-linkslia.addstories-link.linktext,div.article-icon-links-containerul.article-icon-linkslia.removestories-link.linktext{padding-left:15px}div.article-icon-links-containerul.article-icon-linksli.referrerimg{margin-bottom:-1px}.article{margin-bottom:15px;font-size:1.2em}.item.article{font-size:1em}.articlea{color:#004db3}.article.article-topic{font-weight:bold;text-transform:uppercase;border-bottom:1pxsolid#f00}.article.articletext{padding:5px04px}.article.articletextimg{float:left;margin:08px5px0}.article-tri-headline.articletextimg{margin-right:0}.article.articletextp{min-height:auto}.article.channel-date-container{font-weight:bold;margin-bottom:5px}.article.channel-date-container.channel-intro{padding:1px6px;margin-right:8px;float:left}.article-small,.item.article-small{margin-bottom:10px}.article-topstoryh2,.article-largeh2,.article-tri-headlineh2,.article-tri-headlineh1{margin:5px00;font-size:2.5em}.article-largeh2,.article-tri-headlineh2,.article-tri-headlineh1{margin-bottom:10px}.article-large.articletext-holder{padding:008px10px;float:left;width:308px}.beta.article-large.articletext-holder,.column-split.article-large.articletext-holder{padding:8px0}.article-smallh2,.article-smallslanth2,.article-star-searchh2,.article-star-searchh3{margin:5px00;font-size:1.3em;font-weight:bold}.article-smallh2{margin:0}.article-smallp{padding-left:0}.article-largeimg{float:left}.article-large.morelinks{border-top:none}.article-largediv.article-icon-links-container{margin-top:10px}.article-large.articletext.morelinks,.article-largeimg{width:308px;float:left}.article-tri-headline.morelinks{padding-top:0;margin-top:0;float:right;width:310px}.articleh2{font-weight:bold}#weather-wrapper{display:none}#dms-txt{display:none}.lightbox-gallery.hidden{display:none}html:not(.molads_billboard_off)#mini-carousel-wrapper{display:none}@mediaonlyscreenand(min-device-width:200px)and(orientation:portrait){html.smart-banner-enabledbody:not(.smart-banner-shown){padding-top:200px}}@mediaonlyscreenand(min-device-width:768px)and(orientation:portrait){html.smart-banner-enabledbody:not(.smart-banner-shown){padding-top:160px}}/*#sourceMappingURL=desktopChannel.css.map*/useGpt=true;PeCriteria=window.PeCriteria||{};PeCriteria.cljVersion='5.365.0';PeCriteria.cljNode='cljfe-b5';PeCriteria.channel='ushome';PeCriteria.subchannel='ushome';PeCriteria.geo=('us'||'GB').toUpperCase();PeCriteria.latitude="51.5072";PeCriteria.longitude="0.1275";PeCriteria.refresh=3600;PeCriteria.refreshTablet=3600;PeCriteria.refreshDesktop=1920;PeCriteria.mailtoEmailLinks=!!'';PeCriteria.geoDesktopPopupEnabled=true;PeCriteria.hideFacebook='';PeCriteria.showFlipboard='true';PeCriteria.showFbMessenger='true';PeCriteria.flyoutExpandOnFirstPlay=false;PeCriteria.safariNewsletterEnabled=false;PeCriteria.desktopDownloadPromptEnabled=true;PeCriteria.safariNewsletterCid='0765aa0e6736e46d0dda6d8b02eb35f7';PeCriteria.safariNewsletterList='cc-prod-all-all';PeCriteria.safariNewsletterDefaultList='news';PeCriteria.safariNewsletterLists=['news','sport','tvshowbiz'];PeCriteria.safariNewsletterUseChannelOwnColor=false;PeCriteria.peType='channel';PeCriteria.showNewzitNotificationPrompt=false;varPUSHLY_DOMAIN_KEY='PYGfY6VSoQx2z2MJUVW0nL7t0AyIAHprQ6IJ';PeCriteria.latitude="39.90";PeCriteria.longitude="116.41";PeCriteria.geo="CN"||PeCriteria.geo;PeCriteria.region="BJ"||'';PeCriteria.timestamp=87;PeCriteria.isMobile="is_mobilefalse";PeCriteria.isMobile=(!!PeCriteria.isMobile)?PeCriteria.isMobile==='is_mobiletrue':undefined;PeCriteria.isTablet="";PeCriteria.isTablet=(!!PeCriteria.isTablet)?PeCriteria.isTablet==='is_tablettrue':undefined;varANDDebugOn=false;vars_account='anddailymailprod';vars_account15='molglobalprod';varheRenderedSponsoredPollOnPe=false;varuseRtp=true;vartwitterVia='MailOnline';varadReferrer='';varadType='dart',dartSiteId="dailymail.uk",adAreaSiteId="dm",adAreaId="ushome",adSubareaId=(adReferrer=="")?""||"ushome":adReferrer,adPeType='hp',adContent="",adSection='',adArticleId="",adEnvironment="production",enableAds=true;///static/mol-fe/static/mol-fe-sync-bundle/6.12.0-pr-319.2216/placeholder/desktop.jswindow.DMPlaceholder={laterQueue:[]};window.DM=window.DM||{later:function(eventNames,callback){if(!callback&&'Promise'inwindow){returnnewPromise(function(resolve){window.DMPlaceholder.laterQueue.push({callback:resolve,eventNames:eventNames});});}else{returnwindow.DMPlaceholder.laterQueue.push({callback:callback,eventNames:eventNames});}}};window.isAdFreeEntitled=function(){try{varafstatus=JSON.parse(window.localStore.getItem('mol-fe-paywall-status'));if(window.PeCriteria&&window.PeCriteria.geo==='US'){returnfalse;}return!afstatus.invalidated&&!afstatus.deviceDisabled&&afstatus.validUntil>Date.now();}catch(error){}returnfalse;};window.adverts=window.adverts||{};window.adverts.config={"__generated.commit.sha":"0d66f5f","__generated.commit.timestamp":"2022-06-23T10:10:21+01:00","abe.allowAbeOutsideOffice":true,"abe.render":{"timeout":300,"messe":"__abe_ad_visible"},"abe.detection":{"timeout":,"waitForEvent":false},"abe.detection.delay":5000,"abe.detection.enabled":true,"abe.detection.maxGAMAdRenderTime":3000,"abe.detection.sessionDepth":2,"abe.detection.testMethod":"testWithDummyAd","abe.iab":{"useAnimationFrame":false},"abe.iab.class":"billboard","adsRefresh":{"interval":,"slots":["sky_left_top","sky_left_bottom","sky_right_top","sky_right_bottom","mpu_left"],"activeViewSlots":[{"pos":"billboard","interval":},{"pos":"leader_top","interval":},{"pos":"mpu_top","interval":},{"pos":"leader_top","interval":},{"pos":"mpu_puff_5","interval":},{"pos":"mpu_puff_10","interval":},{"pos":"mpu_puff_15","interval":},{"pos":"mpu_puff_20","interval":},{"pos":"mpu_puff_30","interval":},{"pos":"mpu_puff_45","interval":},{"pos":"mpu_mobile_top","interval":},{"pos":"mpu_mobile","interval":},{"pos":"mpu_mobile_upper_middle","interval":},{"pos":"mpu_bottom","interval":},{"pos":"mpu_middle","interval":}]},"adserver.ads":[{"id":"newzit-dynamic-300x600","size":[300,600],"url":"scripts.dailymail.co.uk/static/mol-fe/static/mol-fe-xpmodule-news-search/1.13.0/mpuCarousel.html?forceIto=Mol-Carousel&startTab=entertainment"},{"id":"newzit-static-970x250","size":[970,250],"click":"/?ito=MOL_House_Ads","ime":"/static/mol-adverts/creatives/newzit-static-billboard.jpeg"},{"id":"newzit-static-300x250","size":[300,250],"click":"/?ito=MOL_House_Ads","ime":"secure.iad.anm.co.uk/00adops/newzitmpu.png"},{"id":"newzit-static-160x600","size":[160,600],"click":"/?ito=MOL_House_Ads","ime":"/static/mol-adverts/creatives/newzit-static-skyscrapper.png"}],"amazon.pubcommon":{"enabled":true,"loadTimeout":3000,"pubcidScript":"///static/mol-adverts/demo/mol-/dist/pubcid.min.js"},"analytics.bidsHunting":{"positions":["none"]},"analytics.external.bundleVersions":["peMeta","gpt","prebid","ima","permutive"],"arrowKeysScroll.userents":["(Chromium|Chrome)/(\\d+)\\.(\\d+)(?:\\.(\\d+))?","(rv:11\\.0)"],"auction.endpoint":"ib.adnxs.com/openrtb2/prebid","auction.maxTime":2000,"auction.priceGranularity":"dense","auction.secure":1,"bidmax":{"abe":{"timeout":1000},"peTimeout":1000,"reportPlugins":["chromelessv2.dmplayer","scanner","analytics.cwv.cls","players.commercial"]},"bots":[{"ip":"62.25.109.197"},{"ip":"85.115.53.201"}],"ccpa":{"scriptBase":"cmp.dmgmediaprivacy.co.uk/2.8.18-ccpa-31"},"cmp.enable.probability":0,"cmp.enable.userents":["^((?!(FB(AN||BV|RV|DV|MD|SV|SS|CR|ID|LC|OP)\\/)).)*$"],"cmp.disable.clickOverlay.userent":[".*"],"cmp.reprompt":{"version":1,"chance":1},"cmp.scriptBase":"cmp.dmgmediaprivacy.co.uk/2.8.23","cmp.v2":{"noChoice":{"useDissentPluginsWhiteList":true,"forceConfig":{"bidmax.adBlockDetection.fireListeners":false}},"dissent":{"pluginsWhitelist":["abe.thankYouMesse","article","asyncBus","auctionInfo","brandedVideoPlayer","cmp","cmp.reprompt","forceFlyawayPlayerConfig","gpt","headerBidding.bidsReceived","imaSDK","impIDPlugin","maxbid","performanceMonitor","runtimeMesses","scriptLoader","slots.mpuFactBox","slots.mpuMobileFactbox","smartBanner","sortable","sticky.banner","videoFlyout","videoForceFlyout"]}},"controlPanel.scriptURL":"scripts.dailymail.co.uk/static/mol-ads-control-panel/3.8.0/mol-ads-control-panel.js","dfp.networkCode":5765,"dfpAccountCode":5765,"enableCondition":{"notForAuthorTypes":["columnist"]},"headerBidders":{"live-us.andweb.dmgt.net":{"whitelist":["adxChannelPlugin","analytics","analyticsTiming","analyticsViewability","article","asyncBus","auctionInfo","botsPlugin","brandedVideoPlayer","browserResolutionPlugin","cmp","devicePlugin","gpt","imaSDK","impIDPlugin","integral","lotame","maxbid","performanceMonitor","sortable","taboolaAds","taboola","videoForceFlyout","videoFlyout","visits","runtimeMesses"]},"live-uk.andweb.dmgt.net":{"whitelist":["adxChannelPlugin","analytics","analyticsTiming","analyticsViewability","article","asyncBus","auctionInfo","botsPlugin","brandedVideoPlayer","browserResolutionPlugin","cmp","devicePlugin","gpt","imaSDK","impIDPlugin","integral","lotame","maxbid","performanceMonitor","sortable","taboolaAds","taboola","videoForceFlyout","videoFlyout","visits","runtimeMesses"]},"live-au.andweb.dmgt.net":{"whitelist":["adxChannelPlugin","analytics","analyticsTiming","analyticsViewability","article","asyncBus","auctionInfo","botsPlugin","brandedVideoPlayer","browserResolutionPlugin","cmp","devicePlugin","gpt","imaSDK","impIDPlugin","integral","lotame","maxbid","performanceMonitor","sortable","taboolaAds","taboola","videoForceFlyout","videoFlyout","visits","runtimeMesses"]}},"molFeSmartBanner":{"ereUserRating":5,"formattedPrice":"FREE-OntheMicrosoftStore","trackCensoredName":"MailOnline","storeUrl":"httpwindowsphone.com/s?appid=fabd0080-9f8a-4f96-b720-78c28ed798b4"},"molFeSmartBanner.app":"mol","instartlogic.plugins.override":["asyncBus","gpt","billboardAdjustments","botsPlugin","adxChannelPlugin","impIDPlugin","audienceMembershipPlugin","browserResolutionPlugin","ix","indexExchange","openx","devicePlugin","vpaid","videoForceFlyout","videoFlyout","auctionInfo","brandedVideoPlayer","maxbid","article","sessionDepth","stickySkies","analytics","analytics.cmp","analytics.rtaIds","analytics.timing","analytics.viewability","visits","pubmatic","rubicon","rubiconVideo","indexExchangeVideo","analytics.adBlockerDetection","adyoulike","amazonPlugin","audienceNetwork","audienceNetworkVideo","sticky.billboard","sticky.mpus","sticky.skies","bidders.amazon","appnexus","taboolaAds"],"amazonPreroll":{"slotId":"ctp_video_desktop","mediaType":"video"},"amazonPreroll.auto-play":{"slotId":"ap_video_desktop","mediaType":"video"},"amazonPreroll.jwplayer":{"slotId":"jw_video_desktop","mediaType":"video"},"display.extraSizes":{"wideSkies":"300x600"},"lotame.consent":{"enabled":true},"lotame.consent.chanceToSendOnPeView":1,"mvt.tests.abe":{"scope":"pe","size":1,"scenarios":{"dummy5":{"config":[{"abe.detection.sessionDepth":0,"abe.detection.delay":5000,"abe.detection.testMethod":"testWithDummyAd","abe.detection.useNextFrame":true}]},"dummy10":{"config":[{"abe.detection.sessionDepth":0,"abe.detection.delay":,"abe.detection.testMethod":"testWithDummyAd","abe.detection.useNextFrame":true}]}}},"mvt.tests.disablePeUnload":{"__targeting":{"browser":["ie"],"payload":{"scope":"pe","size":1,"scenarios":{"active":{"plugins":{"remove":["analytics.peUnload"]}}}}}},"mvt.tests.mm":{"__targeting":{"globalContext":[{"prop":"pemeta.articleId","op":"includes","value":""},{"prop":"pemeta.articleId","op":"includes","value":""},{"prop":"pemeta.articleId","op":"includes","value":""},{"prop":"pemeta.articleId","op":"includes","value":""},{"prop":"pemeta.articleId","op":"includes","value":""}],"payload":{"scope":"pe","size":1,"scenarios":{"disable":{"plugins":{"remove":["slots.minuteMedia"]}}}}}},"mvt.tests.permutive":{"scope":"pe","scenarios":{"on":{"plugins":["permutive","dmp.permutive.video"],"size":0.95},"off":{"size":0.05}}},"mvt.tests.perfMon":{"scope":"pe","size":1,"scenarios":{"on":{"plugins":["performanceMonitor"]},"off":{}}},"mvt.tests.scannerTrial":{"scope":"pe","size":0.6,"scenarios":{"control":{"config":[{"plugins.scanner.provider":"control"}]},"confiant":{"config":[{"plugins.scanner.provider":"confiant"}]}}},"nonAdServable.plugins.whitelist":["api","site","adsFree","messe-trace","conditionalEnable","imeGallery","adListLoader","scriptLoader","peVisibility","runtimeMesses","version","slots.mpuPuffOthers","performance","nonAdServable","smartScheduler","debug.setPlugin","messePluginsFromCreatives","slots.descriptions","conditionalLoad","analytics.coreMetrics","analytics.reportPlugins","takeovers.videowallpaper","adPeType","slotDefinition","slots.delayMount","userId","domain","pe.placement","gpt","impIDPlugin","browserResolutionPlugin","devicePlugin","imaSDK","auctionInfo","brandedVideoPlayer","maxbid","article","performanceMonitor","taboola","visits","taboolaAds","trackers.taboola","domain"],"konduit.id":"5ed6500c9166db0c4e9556ad","prebid.videoAuctionOffset":500,"performance.sampleSize":10,"performance.peLoad.offsets":[0,5,15],"performance.adImpression.offsets":[],"performplayer":{"enabled":true,"url":"//player.performgroup.com/eplayer.js"},"permutive.rtd.auctionDelay":0,"players.chromeless.dmplayer.v2":{"adRequestBaseUrl":"pubads.g.doubleclick.net/gampad/ads","delayBeforeMakingPlayerVisible":4000,"delayBeforeStartPlayer":2000,"schedule":[{"offset":0,"videoAdServerUrl":{"sz":"[size]","iu":"/5765/dm.chromelessvideo/preroll","impl":"s","gdfp_req":1,"env":"vp","output":"xml_vast4","unviewed_position_start":1,"url":"[referrer_url]","correlator":"[time]"},"cust_params":{"pos":"jw_preroll"}},{"videoAdServerUrl":{"sz":"[size]","iu":"/5765/dm.chromelessvideo/midroll","impl":"s","gdfp_req":1,"env":"vp","output":"xml_vast4","unviewed_position_start":1,"url":"[referrer_url]","correlator":"[time]"},"cust_params":{"pos":"jw_midroll"},"minVideoDuration":15,"offset":15},{"videoAdServerUrl":{"sz":"[size]","iu":"/5765/dm.chromelessvideo/midroll","impl":"s","gdfp_req":1,"env":"vp","output":"xml_vast4","unviewed_position_start":1,"url":"[referrer_url]","correlator":"[time]"},"cust_params":{"pos":"jw_postroll"},"minVideoDuration":40,"offset":40}]},"players.chromeless.dmplayer.v2.adUnitName":"dm_dmros_ros","players.chromeless.dmplayer.v2.domainExclusions":["thisismoney.co.uk"],"players.chromeless.dmplayer.v2.disableMolTracking":false,"players.chromeless.dmplayer.v2.enableWifiDetection":false,"players.chromeless.dmplayer.v3.adRoll":[{"offset":0,"pos":"preroll","cust_params":{"pos":"jw_preroll"}},{"offset":15,"pos":"midroll","minVideoDuration":15,"cust_params":{"pos":"jw_midroll"}},{"offset":40,"pos":"midroll","minVideoDuration":40,"cust_params":{"pos":"jw_postroll"}}],"players.chromeless.dmplayer.v3.adUnitNameLevel2":"dm_dmros_ros","players.chromeless.dmplayer.v3.dfpAccountCode":5765,"players.commercial.midRoll":[15,40],"players.commercial.playlistURL":"secured.dailymail.co.uk/feeds/commercial/topVideos.json","players.commercial.poster":false,"players.flyoutConfig":{"pauseAdsOnBlur":true,"pauseWhenUserInOtherTab":true,"pauseWhenUserInOtherApplication":true},"players.dmplayer":{"pauseOnVisibilityChange":false,"pauseOnBlur":false,"minCalculatedWidthForVideo":640,"useMinimumWidthForMobile":true,"pauseOnAds":true},"players.editorial":{"adUnitName":"dm_dmros_ros","adRequestBaseUrl":"pubads.g.doubleclick.net/gampad/ads","videoAdServerUrl":{"sz":"[size]","iu":"/5765/dm.video","impl":"s","gdfp_req":1,"env":"vp","output":"xml_vast4","unviewed_position_start":1,"url":"[referrer_url]","correlator":"[time]"},"preRoll":true,"midRollRepeat":{"each":30,"videoDurationExceeds":15}},"players.editorial.midRollRepeat.each":600,"players.editorial.v2":{"preRoll":true},"players.editorial.v2.gpid.adUnitNameLevel2":"dm_video_ros","players.setup.earlyAdFactoryInit":true,"pluginManer":{"setupTimeout":},"plugins.audienceProject":{"scriptSrc":"sak.userreport.com/mol/launcher.js"},"plugins.meta":[],"plugins.adnami":{"scriptTimeout":1000},"plugins.adservers.openweb.slots":["mpu_puff_5","mpu_comment_desktop_1"],"plugins.adsFree.enabled":true,"plugins.bidders.33across.display":{"adUnits":{"billboard":{"siteId":"a0rT0o88Cr64kKaKjGFx_2","sizes":[[970,250],[728,90]]},"leader_bottom":{"siteId":"czGjzQ88Cr64fWaKlKyvbs","sizes":[[970,250],[728,90]]},"leader_lower_middle":{"siteId":"cFhfGG88Cr64fWaKlKyvbs","sizes":[[970,250],[728,90]]},"leader_middle":{"siteId":"cJlY5m88Cr64fWaKlKyvbs","sizes":[[970,250],[728,90]]},"leader_very_bottom":{"siteId":"cOriGu88Cr64fWaKlKyvbs","sizes":[[970,250],[728,90]]},"leader_wide":{"siteId":"cSmLMCr64fWaKlKyvbs"},"mpu_bottom":{"siteId":"cXurm888Cr64fWaKlKyvbs"},"mpu_factbox":{"siteId":"c87SRQ88Cr64fWaKlKyvbs"},"mpu_home":{"siteId":"dblt2E88Cr64fWaKlKyvbs"},"mpu_left":{"siteId":"dfkcXG88Cr64fWaKlKyvbs"},"mpu_middle":{"siteId":"djFF6S88Cr64fWaKlKyvbs","sizes":[[300,250]]},"mpu_player":{"siteId":"dSjggY88Cr64fWaKlKyvbs","sizes":[[300,250]]},"mpu_puff_10":{"siteId":"dU5aOA88Cr64fWaKlKyvbs"},"mpu_puff_20":{"siteId":"dYVe4I88Cr64fWaKlKyvbs"},"mpu_puff_30":{"siteId":"d3kp88Cr64fWaKlKyvbs"},"mpu_puff_45":{"siteId":"d7qffG88Cr64fWaKlKyvbs"},"mpu_puff_others":{"siteId":"d_fcNe88Cr64fWaKlKyvbs"},"mpu_top":{"siteId":"acKPZE88Gr64fWaKlKyvbs"},"sky_left_top":{"siteId":"aw6jbo88Gr64fWaKlKyvbs"},"sky_right_top":{"siteId":"azW6xS88Gr64fWaKlKyvbs"}}},"plugins.bidders.adform.display":{"billboard":"970x250,728x90","leader_bottom":"728x90","leader_lower_middle":"728x90","leader_middle":"728x90","leader_top":"728x90","leader_very_bottom":"728x90","leader_wide":"728x90","mpu_bottom":"300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_factbox_others":"300x250","mpu_home":"300x250","mpu_left":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_bottom":"300x250","mpu_mobile_factbox_others":"300x250","mpu_mobile_others":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_player":"300x250","mpu_puff_10":"300x250,300x600","mpu_puff_20":"300x250,300x600","mpu_puff_30":"300x250,300x600","mpu_puff_45":"300x250","mpu_puff_5":"300x250","mpu_puff_others":"300x250,300x600","mpu_top":"300x250,300x600","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250","sky_left_bottom":"120x600,160x600","sky_left_top":"120x600,160x600","sky_right_bottom":"120x600,160x600","sky_right_top":"120x600,160x600","sticky_banner":"320x50"},"plugins.bidders.adform.v2.display":{"adUnits":{"billboard":{"mid":,"sizes":[[970,250],[728,90]]},"leader_bottom":{"mid":,"sizes":[[728,90]]},"leader_lower_middle":{"mid":,"sizes":[[728,90]]},"leader_middle":{"mid":,"sizes":[[728,90]]},"leader_top":{"mid":},"leader_very_bottom":{"mid":,"sizes":[[728,90]]},"leader_wide":{"mid":},"mpu_bottom":{"mid":},"mpu_factbox_other":{"mid":},"mpu_home":{"mid":},"mpu_left":{"mid":},"mpu_middle":{"mid":,"sizes":[[300,250]]},"mpu_player":{"mid":},"mpu_puff_10":{"mid":},"mpu_puff_20":{"mid":},"mpu_puff_30":{"mid":},"mpu_puff_45":{"mid":,"sizes":[[300,250]]},"mpu_puff_5":{"mid":,"sizes":[[300,250]]},"mpu_puff_other":{"mid":},"mpu_top":{"mid":},"sky_left_bottom":{"mid":,"sizes":[[120,600],[160,600]]},"sky_left_top":{"mid":,"sizes":[[120,600],[160,600]]},"sky_right_bottom":{"mid":,"sizes":[[120,600],[160,600]]},"sky_right_top":{"mid":,"sizes":[[120,600],[160,600]]}}},"plugins.bidders.adform.video":{"jwplayer":},"plugins.bidders.adyoulike.display":{"adUnits":{"mpu_mobile_top":"db4e19d00ad17f7fddba6d47fa300x250","mpu_puff_10":"d586f30b2ebbc9e4300x600","mpu_top":"050d141aed1a08adec6a3d2a300x600","sticky_banner":"8d64ae2eeab0407ec37ca0320x50","mpu_puff_20":"136d13cc1773db9e73fbcf7da41300x250"},"wideSkiesAdUnits":{"sky_left_bottom":"9edb80a894ed11f454cde45fbb60a763300x600","sky_left_top":"8eb5049a74a09a668d5ae1bc4f300x600","sky_right_bottom":"e4e1319ca1abcf0d6a04f17b6e0300x600","sky_right_top":"f02b530dccc44cff9a48dc300x600"}},"plugins.bidders.appnexus.display":{"adUnits":{"banner_top":"468x60","billboard":"970x250,728x90","leader_top":"728x90","leader_bottom":["728x90,900x250","970x250"],"leader_lower_middle":["728x90,900x250,970x250","970x250"],"leader_middle":["728x90,900x250,970x250","970x250"],"leader_very_bottom":["728x90,900x250,970x250","970x250"],"leader_wide":"728x90","mpu_bottom":"300x250","mpu_bottom_right":"300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_factbox":"300x250","mpu_home":"300x250","mpu_left":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_bottom":"300x250","mpu_mobile_factbox":"300x250","mpu_mobile_lower_middle":"300x250,300x600","mpu_mobile_top":"300x250,300x600","mpu_mobile_upper_middle":"300x250","mpu_mobile_others":"300x250","mpu_puff_5":"300x250","mpu_puff_10":"300x600,300x250","mpu_puff_15":"300x250,300x600","mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_player":"300x250","mpu_puff_others":"300x600,300x250","mpu_top":"300x600,300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250","sky_left_bottom":"160x600,120x600","sky_right_bottom":"160x600,120x600","sky_right_top":"120x600","sticky_banner":"320x50,300x50,320x100","sticky_banner_gallery_top":"320x50","sticky_banner_gallery_bottom":"320x50"},"wideSkiesAdUnits":{"sky_left_bottom":["300x600","160x600,120x600"],"sky_left_top":["300x600"],"sky_right_bottom":["160x600,120x600","300x600"],"sky_right_top":["120x600","300x600"]}},"plugins.bidders.appnexus.dmps":["admantx","airgrid"],"plugins.bidders.appnexus.video":{"adUnits":{"jwplayer":"3396"}},"plugins.bidders.criteo.display":{"adUnits":{"banner_top":"468x60","billboard":["970x250","900x250","728x90"],"leader_bottom":["728x90","900x250","970x250"],"leader_middle":["728x90","900x250","970x250"],"leader_very_bottom":["728x90","900x250","970x250"],"leader_wide":"728x90","leader_top":"728x90","mpu_bottom":"300x250","mpu_bottom_right":"300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_home":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_bottom":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_mobile_others":"300x250","mpu_puff_10":["300x600,300x250","300x250","300x600"],"mpu_puff_15":["300x250,300x600","300x250","300x600"],"mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_puff_others":"300x600,300x250","mpu_top":"300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250","sky_left_bottom":"160x600,120x600","sky_left_top":["120x600","160x600"],"sky_right_bottom":"160x600,120x600","sky_right_top":["160x600,120x600","120x600","160x600"],"sticky_banner":"320x50","sticky_banner_gallery_top":"320x50","sticky_banner_gallery_bottom":"320x50"},"wideSkiesAdUnits":{"sky_left_bottom":"300x600,160x600,120x600","sky_left_top":["120x600","160x600","300x600"],"sky_right_bottom":"300x600,160x600,120x600","sky_right_top":["300x600,160x600,120x600","120x600","160x600","300x600"]}},"plugins.bidders.criteo.v2.display":{"adUnits":{"banner_top":[[468,60]],"billboard":[[970,250],[900,250],[728,90]],"leader_bottom":[[970,250],[900,250],[728,90]],"leader_middle":[[970,250],[900,250],[728,90]],"leader_top":[[728,90]],"leader_very_bottom":[[970,250],[900,250],[728,90]],"leader_wide":[[728,90]],"mpu_bottom":[[300,250]],"mpu_bottom_right":[[300,250]],"mpu_comments_1":[[300,250]],"mpu_comments_2":[[300,250]],"mpu_factbox":[[300,250]],"mpu_home":[[300,250]],"mpu_middle":[[300,250]],"mpu_left":[[300,250]],"mpu_mobile":[[300,250]],"mpu_mobile_bottom":[[300,250]],"mpu_mobile_factbox":[[300,250]],"mpu_mobile_lower_middle":[[300,250]],"mpu_mobile_others":[[300,250]],"mpu_mobile_top":[[300,250]],"mpu_mobile_upper_middle":[[300,250]],"mpu_puff_10":[[300,600],[300,250]],"mpu_puff_15":[[300,600],[300,250]],"mpu_puff_20":[[300,250]],"mpu_puff_30":[[300,250]],"mpu_puff_45":[[300,250]],"mpu_player":[[300,250]],"mpu_puff_others":[[300,600],[300,250]],"mpu_top":[[300,250]],"puff_ad_3":[[300,250]],"puff_ad_6":[[300,250]],"puff_ad_9":[[300,250]],"puff_ad_others":[[300,250]],"sky_left_bottom":[[160,600],[120,600]],"sky_left_top":[[160,600],[120,600]],"sky_right_bottom":[[160,600],[120,600]],"sky_right_top":[[160,600],[120,600]],"sticky_banner":[[320,50]]},"wideSkiesAdUnits":{"sky_left_bottom":[[300,600],[160,600],[120,600]],"sky_left_top":[[300,600],[160,600],[120,600]],"sky_right_bottom":[[300,600],[160,600],[120,600]],"sky_right_top":[[300,600],[160,600],[120,600]]}},"plugins.bidders.criteo.v2.networkId":,"plugins.bidders.improveDigital.display":{"enabled":true,"adUnits":{"banner":"468x60","leader_bottom":"970x250","leader_lower_middle":"970x250","leader_very_bottom":"970x250","mpu_bottom":"300x250","mpu_home":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_puff_10":"300x600","mpu_puff_15":"300x250","mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_top":"300x600","puff_ad_3":"300x250","sky_left_bottom":"160x600","sky_right_bottom":"160x600","sky_left_top":"160x600","sky_right_top":"160x600","sticky_banner":"320x50","billboard":"970x250"}},"plugins.bidders.improveDisplay":[{"code":"ldr_top","placementId":,"sizes":[[728,90]]},{"code":"billboard","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_bottom","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_lower_middle","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_middle","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_top","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_very_bottom","placementId":,"sizes":[[728,90],[970,250]]},{"code":"leader_wide","placementId":,"sizes":[[728,90]]},{"code":"mpu_bottom","placementId":,"sizes":[[300,250]]},{"code":"mpu_bottom_right","placementId":,"sizes":[[300,250]]},{"code":"mpu_comments_1","placementId":,"sizes":[[300,250]]},{"code":"mpu_comments_2","placementId":,"sizes":[[300,250]]},{"code":"mpu_factbox","placementId":,"sizes":[[300,250]]},{"code":"mpu_home","placementId":,"sizes":[[300,250]]},{"code":"mpu_left","placementId":,"sizes":[[300,250]]},{"code":"mpu_middle","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_bottom","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_factbox","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_lower_middle","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_others","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_top_skin","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_top","placementId":,"sizes":[[300,250]]},{"code":"mpu_mobile_upper_middle","placementId":,"sizes":[[300,250]]},{"code":"mpu_player","placementId":,"sizes":[[300,250]]},{"code":"mpu_puff_10","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_15","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_20","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_30","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_45","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_5","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_puff_others","placementId":,"sizes":[[300,250],[300,600]]},{"code":"mpu_top","placementId":,"sizes":[[300,250]]},{"code":"puff_ad_3","placementId":,"sizes":[[300,250]]},{"code":"puff_ad_6","placementId":,"sizes":[[300,250]]},{"code":"puff_ad_9","placementId":,"sizes":[[300,250]]},{"code":"puff_ad_others","placementId":,"sizes":[[300,250]]},{"code":"sky_left_bottom","placementId":,"sizes":[[300,600],[300,250],[120,600],[160,600]]},{"code":"sky_left_top","placementId":,"sizes":[[300,600],[300,250],[120,600],[160,600]]},{"code":"sky_right_bottom","placementId":,"sizes":[[300,600],[300,250],[120,600],[160,600]]},{"code":"sky_right_top","placementId":,"sizes":[[300,600],[300,250],[120,600],[160,600]]},{"code":"sticky_banner_skin","placementId":,"sizes":[[320,250]]},{"code":"sticky_banner","placementId":,"sizes":[[320,250],[320,100]]},{"code":"sticky_banner_gallery_bottom","placementId":,"sizes":[[320,250],[320,100]]},{"code":"sticky_banner_gallery_top","placementId":,"sizes":[[320,250],[320,100]]}],"plugins.bidders.improveVideo":{"jwplayer":,"video":{"autoplay":}},"plugins.bidders.inskin.display":{"adUnits":{"billboard":"9874970x250,900x250,728x90"}},"plugins.bidders.ix.display":{"adUnits":{"banner_top":"468x60","billboard":"970x250,900x250,728x90","leader_bottom":"728x90,900x250,970x250","leader_middle":"728x90,900x250,970x250","leader_top":"728x90","leader_very_bottom":"728x90,900x250,970x250","mpu_boHome | Daily Mail Onlinettom":"300x250","mpu_bottom_right":"300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_factbox":"300x250","mpu_home":"300x250","mpu_left":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_bottom":"300x250","mpu_mobile_factbox":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_mobile_others":"300x250","mpu_puff_5":"300x250","mpu_puff_10":"300x600,300x250","mpu_puff_15":"300x250,300x600","mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_player":"300x250","mpu_puff_others":"300x600,300x250","mpu_top":"300x600,300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250","sky_left_bottom":"160x600,120x600","sky_left_top":"160x600,120x600","sky_right_bottom":"160x600,120x600","sky_right_top":"160x600,120x600","sticky_banner":"320x50","sticky_banner_gallery_top":"320x50","sticky_banner_gallery_bottom":"320x50"}},"plugins.bidders.ix.v2.display":{"adUnits":{"banner_top":{"siteId":},"billboard":{"siteId":},"leader_bottom":{"siteId":},"leader_middle":{"siteId":},"leader_top":{"siteId":},"leader_very_bottom":{"siteId":},"mpu_bottom":{"siteId":},"mpu_bottom_right":{"siteId":},"mpu_factbox":{"siteId":},"mpu_home":{"siteId":},"mpu_left":{"siteId":},"mpu_middle":{"siteId":,"sizes":[[300,250]]},"mpu_puff_5":{"siteId":,"sizes":[[300,250]]},"mpu_puff_10":{"siteId":},"mpu_puff_15":{"siteId":},"mpu_puff_20":{"siteId":,"sizes":[[300,250]]},"mpu_puff_30":{"siteId":,"sizes":[[300,250]]},"mpu_puff_45":{"siteId":,"sizes":[[300,250]]},"mpu_player":{"siteId":},"mpu_puff_others":{"siteId":},"mpu_top":{"siteId":},"sky_left_bottom":{"siteId":,"sizes":[[160,600],[120,600]]},"sky_left_top":{"siteId":,"sizes":[[160,600],[120,600]]},"sky_right_bottom":{"siteId":,"sizes":[[160,600],[120,600]]},"sky_right_top":{"siteId":,"sizes":[[160,600],[120,600]]}}},"plugins.bidders.ix.video":{"adUnits":{"jwplayer":,"video":{"ctp":,"autoplay":}}},"plugins.bidders.ix.video.default":{"mimes":["video/mp4","video/webm","application/jascript"],"minduration":0,"protocols":[2,3,5,6],"api":[1,2]},"plugins.bidders.justpremium.display":{"adUnits":{"billboard":"970x250","sticky_banner":"320x50"}},"plugins.bidders.kargo.display":{"adUnits":{"mpu_mobile_top":"_qHs31JqZVr300x250","mpu_mobile_upper_middle":"_u5bfsfROcU300x250","mpu_mobile_lower_middle":"_pyEefdsyfH300x250","mpu_mobile_others":"_cQLzEmkSAc300x250","mpu_mobile_bottom":"_urAaf4wa1y300x250","mpu_mobile_factbox":"_qCGsciUl4Q300x250","sticky_banner":"_r5MsQpfh3z320x50","sticky_banner_gallery_bottom":"_gSVftJvgJb320x50"}},"plugins.bidders.oath.video":{"pubId":"MailOnline"},"plugins.bidders.openx.video":{"delDomain":"mailonline-uk-d.openx.net","adUnits":{"jwplayer":8,"video":{"ctp":0,"autoplay":3}}},"plugins.bidders.openx.display.v2":{"delDomain":"mailonline-uk-d.openx.net","adUnits":{"banner_top":"2468x60","leader_top":"9728x90","leader_wide":"4728x90","mpu_bottom":"8300x250","mpu_bottom_right":"9300x250","mpu_factbox":"1300x250","mpu_home":"0300x250","mpu_left":"9300x250","mpu_middle":"1300x250","mpu_mobile":"0300x250","mpu_mobile_factbox":"2300x250","mpu_mobile_bottom":"1300x250","mpu_mobile_lower_middle":"2300x250","mpu_mobile_top":"3300x250","mpu_mobile_upper_middle":"4300x250","mpu_mobile_others":"6300x250","mpu_puff_5":"8300x250","mpu_puff_10":"2300x600,300x250","mpu_puff_15":"3300x250,300x600","mpu_puff_20":"4300x250","mpu_puff_30":"5300x250","mpu_puff_45":"6300x250","mpu_player":"2300x250","mpu_puff_others":"1300x600,300x250","mpu_top":"9300x250","puff_ad_3":"3300x250","puff_ad_6":"4300x250","puff_ad_9":"4300x250","puff_ad_others":"7300x250","sky_left_bottom":"6160x600,120x600","sky_left_top":"7160x600,120x600","sky_right_bottom":"7160x600,120x600","sky_right_top":"8160x600,120x600","sticky_banner":"9320x50","sticky_banner_gallery_top":"6320x50","sticky_banner_gallery_bottom":"3320x50"}},"plugins.bidders.ozone.siteId":"50","plugins.bidders.ozone.publisherId":"OZONEDMGT002","plugins.bidders.ozone.display.adUnits":{"billboard":82,"sky_right_top":83,"sky_left_top":84},"plugins.bidders.medirid.display":{"sky_left_top":"6599300x600,160x600,120x600,300x250","sky_right_top":"6600300x600,160x600,120x600,300x250","sky_left_bottom":"6601300x600,160x600,120x600,300x250","sky_right_bottom":"6602300x600,160x600,120x600,300x250","billboard":"6685728x90,970x250","leader_top":"6643728x90","mpu_top":"6557300x250,300x600","mpu_puff_10":"6558300x250,300x600","mpu_puff_15":"6559300x250,300x600","mpu_puff_20":"6447300x250","mpu_puff_30":"6448300x250","mpu_puff_45":"6560300x250,300x600","mpu_puff_others":"6561300x250,300x600","mpu_home":"6449300x250","mpu_bottom":"6450300x250","leader_middle":"6686728x90,970x250","leader_bottom":"6687728x90,970x250","leader_very_bottom":"6688728x90,970x250","mpu_left":"6451300x250","mpu_factbox":"6452300x250"},"plugins.bidders.medirid.v2.display":{"adUnits":{"sky_left_top":{"uid":6599},"sky_right_top":{"uid":6600},"sky_left_bottom":{"uid":6601},"sky_right_bottom":{"uid":6602},"billboard":{"uid":6685,"sizes":[[728,90],[970,250]]},"leader_top":{"uid":6643},"mpu_top":{"uid":6557},"mpu_puff_10":{"uid":6558},"mpu_puff_15":{"uid":6559},"mpu_puff_20":{"uid":6447,"sizes":[[300,250]]},"mpu_puff_30":{"uid":6448,"sizes":[[300,250]]},"mpu_puff_45":{"uid":6560},"mpu_puff_others":{"uid":6561},"mpu_home":{"uid":6449},"mpu_bottom":{"uid":6450},"leader_middle":{"uid":6686,"sizes":[[728,90],[970,250]]},"leader_bottom":{"uid":6687,"sizes":[[728,90],[970,250]]},"leader_very_bottom":{"uid":6688,"sizes":[[728,90],[970,250]]},"mpu_left":{"uid":6451},"mpu_factbox":{"uid":6452}}},"plugins.bidders.medirid.video":{"video":6716,"jwplayer":6713},"plugins.bidders.pubmatic.display.v2":{"publisherId":,"adUnits":{"billboard":"billboard728x90,900x250,970x250","leader_bottom":"leader_bottom970x250,900x250,728x90","leader_middle":"leader_middle970x250,900x250,728x90","leader_top":"728x90","leader_very_bottom":"leader_very_bottom970x250,900x250,728x90","leader_wide":"leader_wide728x90","mpu_bottom":"mpu_bottom300x250","mpu_bottom_right":"mpu_bottom_right300x250","mpu_comments_1":"mpu_comments_1300x250","mpu_comments_2":"mpu_comments_2300x250","mpu_factbox":"mpu_factbox300x250","mpu_home":"mpu_home300x250","mpu_left":"mpu_left300x250","mpu_middle":"mpu_middle300x250","mpu_mobile":"mpu_mobile300x250","mpu_mobile_factbox":"mpu_mobile_factbox300x250","mpu_mobile_lower_middle":"mpu_mobile_lower_middle300x250","mpu_mobile_top":"mpu_mobile_top300x250","mpu_mobile_upper_middle":"mpu_mobile_upper_middle300x250","mpu_mobile_others":"mpu_mobile_others300x250","mpu_puff_10":"mpu_puff_10300x600,300x250","mpu_puff_15":"mpu_puff_15300x600,300x250","mpu_puff_20":"mpu_puff_20300x250","mpu_puff_30":"mpu_puff_30300x250","mpu_puff_45":"mpu_puff_45300x250","mpu_player":"mpu_player300x250","mpu_puff_others":"300x600,300x250","puff_ad_3":"puff_ad_3300x250","puff_ad_others":"puff_ad_others300x250","sky_left_bottom":"sky_left_bottom160x600","sky_left_top":"sky_left_top160x600","sky_right_bottom":"sky_right_bottom160x600","sky_right_top":"sky_right_top160x600,120x600","sticky_banner":"sticky_banner320x50,300x50,320x100","sticky_banner_gallery_top":"sticky_banner_gallery_top320x50","sticky_banner_gallery_bottom":"sticky_banner_gallery_bottom320x50"},"wideSkiesAdUnits":{"sky_left_bottom":"sky_left_bottom160x600,300x600","sky_left_top":"sky_left_top300x600,160x600","sky_right_bottom":"sky_right_bottom160x600,300x600","sky_right_top":"sky_right_top300x600,160x600,120x600"}},"plugins.bidders.pubmatic.display.netMultiplier":0.93,"plugins.bidders.pubmatic.video.irisTv.enabled":true,"plugins.bidders.pulsepoint.display":{"cp":,"adUnits":{"billboard":["970x250","728x90"],"leader_bottom":["728x90","970x250"],"leader_middle":["728x90","970x250"],"leader_very_bottom":["728x90","970x250"],"mpu_bottom":"300x250","mpu_bottom_right":"300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_home":"300x250","mpu_middle":"300x250","mpu_mobile":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_puff_10":["300x250","300x600"],"mpu_puff_15":["300x250","300x600"],"mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_top":"300x600","puff_ad_3":"300x250","sky_left_bottom":"160x600","sky_right_bottom":"160x600","sticky_banner":"320x50"},"wideSkiesAdUnits":{"sky_left_bottom":["300x600","160x600"],"sky_right_bottom":["300x600","160x600"]}},"plugins.bidders.rhythmOne":{"adUnits":{"billboard":{"placementId":,"sizes":[[970,250],[728,90]]},"leader_bottom":{"placementId":,"sizes":[[970,250],[728,90]]},"leader_lower_middle":{"placementId":,"sizes":[[970,250],[728,90]]},"leader_middle":{"placementId":,"sizes":[[970,250],[728,90]]},"leader_very_bottom":{"placementId":,"sizes":[[970,250],[728,90]]},"leader_wide":{"placementId":},"mpu_bottom":{"placementId":},"mpu_factbox":{"placementId":},"mpu_home":{"placementId":},"mpu_left":{"placementId":},"mpu_middle":{"placementId":,"sizes":[[300,250]]},"mpu_player":{"placementId":,"sizes":[[300,250]]},"mpu_puff_10":{"placementId":},"mpu_puff_20":{"placementId":},"mpu_puff_30":{"placementId":},"mpu_puff_45":{"placementId":},"mpu_puff_other":{"placementId":},"mpu_top":{"placementId":},"sky_left_top":{"placementId":},"sky_right_top":{"placementId":},"sticky_banner_gallery_bottom":{"placementId":},"sticky_banner_gallery_top":{"placementId":}}},"plugins.bidders.rhythmOne.video":{"adUnits":{"jwplayer":,"ctp":,"autoplay":}},"plugins.bidders.rubicon.display.v2":{"accountId":8625,"siteId":,"atf":["sky_right_top","sky_left_top","billboard","mpu_top","mpu_puff_10","mpu_puff_15","sticky_banner","mpu_mobile_top","leader_top"],"adUnits":{"banner_top":"468x60","sticky_banner":"320x50","leader_middle":"728x90,900x250,970x250","leader_bottom":"728x90,970x250","leader_top":"728x90","leader_wide":"728x90","leader_very_bottom":"728x90,900x250,970x250","billboard":"970x250,728x90","sky_left_top":"160x600,120x600","sky_left_bottom":"160x600,120x600","sky_right_top":"160x600,120x600","sky_right_bottom":"160x600,120x600","mpu_bottom":"300x250","mpu_bottom_right":"300x250","mpu_factbox":"300x250","mpu_home":"300x250","mpu_left":"300x250","mpu_mobile":"300x250","mpu_mobile_factbox":"300x250","mpu_mobile_top":"300x250,300x600","mpu_mobile_upper_middle":"300x250","mpu_mobile_lower_middle":"300x250,300x600","mpu_mobile_bottom":"300x250","mpu_mobile_others":"300x250","mpu_top":"300x600,300x250","mpu_puff_5":"300x250","mpu_puff_10":"300x600,300x250","mpu_puff_15":"300x250,300x600","mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_player":"300x250","mpu_puff_others":"300x600,300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_middle":"300x250","puff_ad_1":"300x250","puff_ad_2":"300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250","sticky_banner_gallery_top":"320x50","sticky_banner_gallery_bottom":"320x50"},"wideSkiesAdUnits":{"sky_left_bottom":"300x600,160x600,120x600","sky_left_top":"300x600,160x600,120x600","sky_right_bottom":"300x600,160x600,120x600","sky_right_top":"300x600,160x600,120x600"}},"plugins.bidders.rubicon.video":{"accountId":8625,"adUnits":{"jwplayer":""}},"plugins.bidders.rubiMM.display":{"accountId":8625,"siteId":,"atf":["sky_right_top","sky_left_top","billboard","mpu_top","mpu_puff_10","mpu_puff_15","sticky_banner","mpu_mobile_top","leader_top"],"adUnits":{"banner_top":"468x60","sticky_banner":"320x50","leader_middle":"728x90,900x250,970x250","leader_bottom":"728x90,970x250","leader_top":"728x90","leader_wide":"728x90","leader_very_bottom":"728x90,900x250,970x250","billboard":"970x250,728x90","sky_left_top":"160x600,120x600","sky_left_bottom":"160x600,120x600","sky_right_top":"160x600,120x600","sky_right_bottom":"160x600,120x600","mpu_bottom":"300x250","mpu_bottom_right":"300x250","mpu_home":"300x250","mpu_mobile":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile_bottom":"300x250","mpu_mobile_others":"300x250","mpu_top":"300x600,300x250","mpu_puff_5":"300x250","mpu_puff_10":"300x600,300x250","mpu_puff_15":"300x250,300x600","mpu_puff_20":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","mpu_puff_others":"300x600,300x250","mpu_comments_1":"300x250","mpu_comments_2":"300x250","mpu_middle":"300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250","puff_ad_others":"300x250"},"wideSkiesAdUnits":{"sky_left_bottom":"300x600,160x600,120x600","sky_left_top":"300x600,160x600,120x600","sky_right_bottom":"300x600,160x600,120x600","sky_right_top":"300x600,160x600,120x600"}},"plugins.bidders.rubiMM.video":{"accountId":8625,"adUnits":{"jwplayer":""}},"plugins.bidders.sharethrough.v2.display":{"adUnits":{"mpu_bottom":{"pkey":"th4WknU2x5F7LeGKXwtZc6fN"},"mpu_home":{"pkey":"PXdw3iXNtMMXYwLKms7NBR"},"mpu_middle":{"pkey":"UE1ipEDEKoyyb15cvRxTAmVB","sizes":[[300,250]]},"mpu_puff_10":{"pkey":"sJBf4NEnVoSDexC1NazdV6h3"},"mpu_puff_15":{"pkey":"6QzdTnugEKMYiUEr5bbKJmmS"},"mpu_puff_20":{"pkey":"YAXW2p8nPTWGVCrPcj5NrxpA","sizes":[[300,250]]},"mpu_puff_30":{"pkey":"wUkCBBbYN6NAeXw2ZxLVpPPL"},"mpu_puff_45":{"pkey":"M46LPS2pKznZDhrVQRRVFfdn","sizes":[[300,250]]},"mpu_puff_others":{"pkey":"BLvCDdsdEkMa2zeVNgSR98gL"},"mpu_top":{"pkey":"t7x4dsgHox9LRR8hNFR7Yyzv"},"sky_left_top":{"pkey":"mDYufSNjn6gUsPvDghG42mG6"},"sky_right_top":{"pkey":"77KLm6Ar3LiwYgCjLn6WXoM1"}}},"plugins.bidders.smartAdServer":{"peId":,"siteId":,"adUnits":{"banner_top":{"formatId":},"billboard":{"formatId":},"half_mpu_top":{"formatId":},"inread_player":{"formatId":},"inread_player_top":{"formatId":},"leader_bottom":{"formatId":},"leader_lower_middle":{"formatId":},"leader_middle":{"formatId":},"leader_top":{"formatId":},"leader_very_bottom":{"formatId":},"leader_wide":{"formatId":},"mpu_bottom":{"formatId":},"mpu_bottom_right":{"formatId":},"mpu_comments_1":{"formatId":},"mpu_comments_2":{"formatId":},"mpu_factbox":{"formatId":},"mpu_home":{"formatId":},"mpu_left":{"formatId":},"mpu_middle":{"formatId":},"mpu_mobile":{"formatId":},"mpu_mobile_bottom":{"formatId":},"mpu_mobile_factbox":{"formatId":},"mpu_mobile_lower_middle":{"formatId":,"sizes":[[300,250]]},"mpu_mobile_other":{"formatId":,"sizes":[[300,250]]},"mpu_mobile_top":{"formatId":,"sizes":[[300,250]]},"mpu_mobile_upper_middle":{"formatId":,"sizes":[[300,250]]},"mpu_player":{"formatId":,"sizes":[[300,250]]},"mpu_puff_10":{"formatId":},"mpu_puff_20":{"formatId":},"mpu_puff_30":{"formatId":},"mpu_puff_45":{"formatId":},"mpu_puff_5":{"formatId":},"mpu_puff_other":{"formatId":},"mpu_top":{"formatId":},"puff_ad_3":{"formatId":,"sizes":[[300,250]]},"puff_ad_6":{"formatId":,"sizes":[[300,250]]},"puff_ad_9":{"formatId":,"sizes":[[300,250]]},"puff_ad_other":{"formatId":,"sizes":[[300,250]]},"sky_left_bottom":{"formatId":},"sky_left_top":{"formatId":},"sky_right_bottom":{"formatId":},"sky_right_top":{"formatId":},"sticky_banner":{"formatId":},"sticky_banner_gallery_bottom":{"formatId":},"sticky_banner_gallery_top":{"formatId":}}},"plugins.bidders.smartAdServer.video":{"formatId":},"plugins.bidders.spotx.video":{"autoplay":,"ctp":,"chromeless":},"plugins.bidders.teads.display":{"adUnits":{"puff_ad_other":"300x250","mpu_puff_other":"300x250","mpu_factbox":"300x250","mpu_mobile_factbox":"300x250","mpu_top":"300x250","mpu_mobile_top":"300x250","mpu_mobile_upper_middle":"300x250","mpu_mobile_lower_middle":"300x250","mpu_mobile":"300x250","mpu_puff_20":"300x250","billboard":"300x250","mpu_puff_10":"300x250","mpu_puff_30":"300x250","mpu_puff_45":"300x250","puff_ad_3":"300x250","puff_ad_6":"300x250","puff_ad_9":"300x250"}},"plugins.bidders.triplelift.display":{"adUnits":{"leader_bottom":"dailymail_desktop_leader_bottom_prebid728x90,900x250,970x250","leader_lower_middle":"dailymail_desktop_leader_lower_middle_prebid728x90,900x250,970x250","leader_middle":"dailymail_desktop_leader_middle_prebid728x90,900x250,970x250","leader_top":"dailymail_desktop_leader_top_prebid728x90","leader_very_bottom":"dailymail_desktop_leader_very_bottom_prebid728x90,900x250,970x250","mpu_puff_5":"dailymail_desktop_box_mpu_puff_5_prebid300x250","mpu_puff_10":"dailymail_desktop_box_mpu_puff_10_prebid300x250","mpu_puff_15":"dailymail_desktop_box_mpu_puff_15_prebid300x250","mpu_puff_20":"dailymail_desktop_box_mpu_puff_20_prebid300x250","mpu_puff_30":"dailymail_desktop_box_mpu_puff_30_prebid300x250","mpu_puff_45":"dailymail_desktop_box_mpu_puff_45_prebid300x250","mpu_puff_others":"dailymail_desktop_box_mpu_puff_other_prebid300x250","mpu_top":"dailymail_desktop_box_mpu_top_prebid300x250","mpu_left":"dailymail_mpu_desktop_left_HDX_prebid300x250","sky_left_top":"dailymail_sky_left_desktop_top_160x600_prebid120x600,160x600","sky_right_top":"dailymail_sky_right_desktop_top_160x600_prebid120x600,160x600","mpu_factbox":"dailymail_desktop_mpu_factbox_prebid300x250"},"wideSkiesAdUnits":{"sky_left_top":"dailymail_sky_left_desktop_top_prebid300x250,300x600","sky_right_top":"dailymail_sky_right_desktop_top_prebid300x250,300x600"}},"plugins.bidders.triplelift.video":{"adUnits":{"jwplayer":"dailymail_prebid_commercial_player_ctp_intstream","video":{"ctp":"dailymail_prebid_editorial_player_ctp_intstream","autoplay":"dailymail_prebid_editorial_player_ap_intstream"}}},"plugins.bidders.verizon.display":{"dcn":"8aaaede3c85d0ab0026","posPrefix":"desktop"},"plugins.bidders.verizon.display.adUnits":{"billboard":[[970,250],[728,90]],"leader_bottom":[[728,90],[970,250]],"leader_middle":[[728,90],[970,250]],"leader_top":[[728,90]],"leader_very_bottom":[[728,90],[970,250]],"mpu_bottom":[[300,250]],"mpu_home":[[300,250]],"mpu_puff_10":[[300,250]],"mpu_puff_15":[[300,250]],"mpu_puff_20":[[300,250]],"mpu_puff_30":[[300,250]],"mpu_puff_45":[[300,250]],"mpu_player":[[300,250]],"mpu_left":[[300,250]],"mpu_puff_others":[[300,250],[300,600]],"mpu_top":[[300,600],[300,250]],"mpu_factbox":[[300,250]],"sky_left_bottom":[[160,600],[120,600],[300,600],[300,250]],"sky_left_top":[[160,600],[120,600],[300,600],[300,250]],"sky_right_bottom":[[160,600],[120,600],[300,600],[300,250]],"sky_right_top":[[160,600],[120,600],[300,600],[300,250]]},"plugins.bidders.verizon.singleRequestMode":false,"plugins.bidders.verizon.v2.display":{"dcn":"8aaaede3c85d0ab0026","posPrefix":"desktop"},"plugins.bidders.verizon.v2.display.adUnits":{"billboard":{"sizes":[[970,250],[728,90]]},"leader_bottom":{"sizes":[[728,90],[970,250]]},"leader_middle":{"sizes":[[728,90],[970,250]]},"leader_top":{},"leader_very_bottom":{"sizes":[[728,90],[970,250]]},"mpu_bottom":{},"mpu_home":{},"mpu_puff_10":{"sizes":[[300,250]]},"mpu_puff_15":{"sizes":[[300,250]]},"mpu_puff_20":{"sizes":[[300,250]]},"mpu_puff_30":{"sizes":[[300,250]]},"mpu_puff_45":{"sizes":[[300,250]]},"mpu_player":{},"mpu_left":{},"mpu_puff_others":{},"mpu_top":{},"mpu_factbox":{},"sky_left_bottom":{},"sky_left_top":{},"sky_right_bottom":{},"sky_right_top":{}},"plugins.bidders.verizon.v2.singleRequestMode":false,"plugins.bidders.yahoossp.display":{"dcn":"8aaaede3c85d0ab0026","posPrefix":"desktop"},"plugins.bidders.yahoossp.display.adUnits":{"billboard":{"sizes":[[970,250],[728,90]]},"leader_bottom":{"sizes":[[728,90],[970,250]]},"leader_middle":{"sizes":[[728,90],[970,250]]},"leader_top":{},"leader_very_bottom":{"sizes":[[728,90],[970,250]]},"mpu_bottom":{},"mpu_home":{},"mpu_puff_10":{"sizes":[[300,250]]},"mpu_puff_15":{"sizes":[[300,250]]},"mpu_puff_20":{"sizes":[[300,250]]},"mpu_puff_30":{"sizes":[[300,250]]},"mpu_puff_45":{"sizes":[[300,250]]},"mpu_player":{},"mpu_left":{},"mpu_puff_others":{},"mpu_top":{},"mpu_factbox":{},"sky_left_bottom":{},"sky_left_top":{},"sky_right_bottom":{},"sky_right_top":{}},"plugins.bidders.yahoossp.singleRequestMode":false,"plugins.bidders.yahoossp.video.adUnits":{"jwplayer":{"preroll":{"placementId":"8a9691f5017c7ce6f06bee000b"},"midroll":{"placementId":"8a9695f7017c7ce6f635e00a"}},"video":{"ctp":{"placementId":"8a969dc7ce6eb90ee000d"},"ap":{"placementId":"8a9691f5017c7ce6f06be00c"}}},"plugins.bidders.yahoossp.video.siteId":"8aaaede3c85d0ab0026","plugins.enabled":["asyncBus","mvt","gpt","botsPlugin","impIDPlugin","browserResolutionPlugin","rubicon","devicePlugin","imaSDK","vpaid","auctionInfo","brandedVideoPlayer","maxbid","article","sessionDepth","performanceMonitor","rubiconVideo","taboola","visits","taboolaAds","skimlinks","amazonNative","analytics.rtaIds","analytics.timing","analytics.viewability","appnexusVideo","arrowKeysScroll","billboardAdjustments","fbRemarketingPixel","sticky.mpus","sticky.skies","bidders.amazon","skins","adIntegrator","analytics.abtest","analytics.entryPoint","analytics.store","analytics.memory","analytics.bidmax","players.flyoutManer","bidders.inskin","slots.leaderTop","openxVideo","paidSessions","revenueReporter","trackers.taboola","watershed","abe.errorDetection","abe.rtaTracking","analytics.inputDelays","analytics.bidmaxSendBeacon","domain","trackers.id5","ixVideo","prebidUserSync","programmaticCampaign","rtaPeEventDispatcher","bidders.spotx2","bidders.teads","trackers.adxChannel","trackers.universalid","adsRefresherV2","analytics.bidmaxSendBeaconMigration","analytics.bidsHunting","analytics.cacheIndication","analytics.connection","analytics.customTracking","analytics.cwv","analytics.externalData","analytics.peCriteria","analytics.peUnload","analytics.partners","analytics.scrollDepth","analytics.takeover","analytics.timeSpent","analytics.videoFailures","bidders.adform.display","bidders.adform.video","bidders.appnexus","bidders.appnexusViHome | Daily Mail Onlinedeo","bidders.brightroll","bidders.criteoV2","bidders.ix","bidders.ixVideo","bidders.medirid","bidders.mediridVideo","bidders.openx","bidders.openxVideo","bidders.pubmaticVideo","bidders.rubicon","bidders.rubiconSkin","bidders.sharethrough","bidders.smartAdServer","bidders.smartAdServer.video","bidders.triplelift","bidders.tripleliftVideo","bidsReceived","chromelessv2.dmplayer","controlPanel","dmp.permutive.indexedDBUse","fff","headerBidding.bidsReceived","peArea","permutive.rtd","players.dmplayer","players.targeting","slots.lazyConfig","slots.mpuFactBox","slots.mpuMobileFactbox","slots.refreshInfo","slots.rendered","sticky.psuedoClasses","trackers.pubcommon","trackers.unifiedid","trackers.viewability","abe.analytics","bidders.appnexusPSP","bidders.criteo.video","bidders.verizon2","bidders.yahoossp.display","bidders.yahoossp.video","dmp.moat","gpt-targeting.ga.referrer","pe.homepeRenderPlatform","permutive.vault","prebid.pubcommon","prebid.sharedId","reconfigureSlotsEnabled","trackers.pubProvidedId","slots.InreadPlayerTop","slots.mpuComments"],"plugins.permutive":{"projectId":"6c6bae12-4b51-4602-ae6de99","apiKey":"3ef-86bd-4d8a-a2f7-802b6c3d62a9"},"plugins.prebid.appnexusVideoEnabled.chance":1,"plugins.prebid.async.config.timeout":500,"plugins.prebid.sharedId":{"cookie":{"name":"_pubcid"}},"plugins.rubicon.skin":{"adUnits":[{"code":"billboard","mediaTypes":{"banner":{"sizes":[[970,250],[1800,1000]]}},"bids":[{"bidder":"rubicon","params":{"accountId":8625,"siteId":,"zoneId":}}]}]},"plugins.sharethrough":{"adUnits":[{"pos":"mpu_mobile","sizes":"300x250","placementKey":"67SmTNDmev7tuBJdxXrgizfn"},{"pos":"mpu_mobile_bottom","sizes":"300x250","placementKey":"x78xtQBYusStGmzGaQULfLrK"},{"pos":"mpu_mobile_lower_middle","sizes":"300x250","placementKey":"ejX8cJhH8AtT8mpBmThSLmoy"},{"pos":"mpu_mobile_top","sizes":"300x250","placementKey":"9gB7gxs6pHmD6t77SUopsddr"},{"pos":"mpu_mobile_upper_middle","sizes":"300x250","placementKey":"ryMkxQu9ZYegS3fi6N7VTk3L"},{"pos":"sky_right_top","labelsAny":["extraWide"],"sizes":"160x600","placementKey":"77KLm6Ar3LiwYgCjLn6WXoM1"},{"pos":"sky_right_top","labelsAny":["extraExtraWide"],"sizes":"160x600,300x600","placementKey":"77KLm6Ar3LiwYgCjLn6WXoM1"},{"pos":"mpu_bottom","sizes":"300x250","placementKey":"th4WknU2x5F7LeGKXwtZc6fN"},{"pos":"mpu_comments_1","sizes":"300x250","placementKey":"6NvDvyAB8EbjUii9vBPgHgzw"},{"pos":"mpu_comments_2","sizes":"300x250","placementKey":"q2GN4JwMPLfYFtwR2As5LZA8"},{"pos":"mpu_home","sizes":"300x250","placementKey":"PXdw3iXNtMMXYwLKms7NBR"},{"pos":"mpu_middle","sizes":"300x250","placementKey":"UE1ipEDEKoyyb15cvRxTAmVB"},{"pos":"mpu_puff_10","sizes":"300x250,300x600","placementKey":"sJBf4NEnVoSDexC1NazdV6h3"},{"pos":"mpu_puff_15","sizes":"300x250,300x600","placementKey":"6QzdTnugEKMYiUEr5bbKJmmS"},{"pos":"mpu_puff_20","sizes":"300x250","placementKey":"YAXW2p8nPTWGVCrPcj5NrxpA"},{"pos":"mpu_puff_30","sizes":"300x250,300x600","placementKey":"wUkCBBbYN6NAeXw2ZxLVpPPL"},{"pos":"mpu_puff_45","sizes":"300x250","placementKey":"M46LPS2pKznZDhrVQRRVFfdn"},{"pos":"mpu_puff_others","sizes":"300x250,300x600","placementKey":"BLvCDdsdEkMa2zeVNgSR98gL"},{"pos":"mpu_top","sizes":"300x250,300x600","placementKey":"t7x4dsgHox9LRR8hNFR7Yyzv"},{"pos":"puff_ad_3","sizes":"300x250","placementKey":"s42Jw5e8kA5UQtFzEn8gLy9Y"},{"pos":"sky_left_top","labelsAny":["extraWide"],"sizes":"160x600","placementKey":"mDYufSNjn6gUsPvDghG42mG6"},{"pos":"sky_left_top","labelsAny":["extraExtraWide"],"sizes":"160x600,300x600","placementKey":"mDYufSNjn6gUsPvDghG42mG6"}]},"plugins.scanner.scriptUrl":{"confiant":"confiant-integrations.global.ssl.fastly.net/eCtvSlC8U9hahCOit78rGy74Auc/gpt_and_prebid/config.js","mediaTrust":"scripts.webcontentassessor.com/scripts/bc585bfefc617f742a451b7f4f99b8d4f250b51c2fabb00dee8e855d"},"plugins.slots.descriptions":{},"plugins.slots.leaderTop":{"triggerElementId":"billBoard","offsetBelowElement":0},"plugins.slots.loadConditions":{"constants":{"onlyIfNoTakeover":{"and":[{"isViewPortWidthLargerThan":1200},{"or":[{"not":{"isPosDefined":"billboard"}},{"and":[{"isPosRendered":"billboard"},{"isPosRendered":"billboard-oop"},{"isPosEmpty":"billboard-oop"},{"or":[{"isPosEmpty":"billboard"},{"isAdSmallerThan":{"pos":"billboard","size":[2000,1200]}}]}]}]}]},"onlyIfNoOOPBillboard":{"or":[{"not":{"isPosDefined":"billboard"}},{"and":[{"isPosRendered":"billboard"},{"or":[{"not":{"isPosDefined":"billboard-oop"}},{"and":[{"isPosRendered":"billboard-oop"},{"isPosEmpty":"billboard-oop"}]}]}]}]},"ifNotIeAndOnlyIfNoTakeOver":{"and":[{"not":{"isIE":false}},{"and":[{"isViewPortWidthLargerThan":1200},{"or":[{"not":{"isPosDefined":"billboard"}},{"and":[{"isPosRendered":"billboard"},{"isPosRendered":"billboard-oop"},{"isPosEmpty":"billboard-oop"},{"or":[{"isPosEmpty":"billboard"},{"isAdSmallerThan":{"pos":"billboard","size":[2000,1200]}}]}]}]}]}]},"onlyIfNoTakeoverAndAndLargeViewport":{"and":[{"isViewPortWidthLargerThan":1565},{"or":[{"not":{"isPosDefined":"billboard"}},{"and":[{"isPosRendered":"billboard"},{"isPosRendered":"billboard-oop"},{"isPosEmpty":"billboard-oop"},{"or":[{"isPosEmpty":"billboard"},{"isAdSmallerThan":{"pos":"billboard","size":[2000,1200]}}]}]}]}]},"isWideViewPort":{"isViewPortWidthLargerThan":1200},"onlyIfLargeViewport":{"isViewPortWidthLargerThan":1565},"oopLoadCondition":{"and":[{"isViewPortWidthLargerThan":100},{"isMasterRendered":true}]}}},"plugins.slots.loadConditions.slots":{"sky_left_top":"isWideViewPort","sky_right_top":"isWideViewPort","mpu_left":"onlyIfNoTakeoverAndAndLargeViewport"},"plugins.slots.loadConditions.oopSlots":{},"plugins.slots.outstream.default":{"mediaTypes":{"video":{"playerSize":[480,270],"context":"outstream","mimes":["video/mp4","application/jascript"],"protocols":[1,2,3,4,5,6],"api":[1,2,3,4,5],"linearity":1,"maxduration":60,"skippable":"false,","playback_method":["auto_play_sound_off"]}}},"plugins.slots.properties":{"dcopt":{"banner_top":true,"sticky_banner":true,"leader_top":true,"billboard":true,"fff_overlay":true},"command":{"sticky_banner":"pfadj","fff_overlay":"pfadj"},"conditionalSizes":{"mpu_middle":{"condition":{"and":true,"homeChannel":true,"isPhone":false},"sizes":"300x250"},"mpu_top":{"condition":{"and":true,"homeChannel":true,"isPhone":false},"sizes":"300x250"},"sticky_banner":{"condition":{"isPhone":true},"sizes":"320x50,320x100,300x50"},"sky_left_top":{"condition":{"wideSkies":true},"sizes":"300x600,160x600,120x600,300x250"},"sky_right_top":{"condition":{"wideSkies":true},"sizes":"300x600,160x600,120x600,300x250"},"sky_right_bottom":{"condition":{"wideSkies":true},"sizes":"300x600,160x600,120x600"},"sky_left_bottom":{"condition":{"wideSkies":true},"sizes":"300x600,160x600,120x600"},"puff_ad_3":{"condition":{"or":true,"homeChannel":true,"newsChannel":true},"sizes":"300x250,356x207,371x189"},"puff_ad_6":{"condition":{"or":true,"homeChannel":true,"newsChannel":true},"sizes":"300x250,356x207,371x189"},"mpu_puff_5":{"condition":{"isPhone":true},"sizes":"300x600,300x250"}}},"plugins.slots.video.v2":{"code":"video","peLoadTimeout":5000,"videoAdServerUrl":"httppubads.g.doubleclick.net/gampad/ads?sz=[size]&iu=%2F5765%2Fdm.video%2Fdm_video_news_apfa&ciu_szs=&impl=s&gdfp_req=1&env=vp&output=xml_vast3&unviewed_position_start=1&url=[referrer_url]&correlator=[timestamp]","mediaTypes":{"video":{"playerSize":[636,358],"context":"instream","mimes":["video/mp4","application/jascript"],"protocols":[1,2,3,4,5,6],"api":[1,2],"linearity":1,"minduration":5,"maxduration":30}},"bids":[]},"plugins.slots.jwplayer.v2":{"code":"jwplayer","mediaTypes":{"video":{"playerSize":[401,225],"context":"instream","mimes":["video/mp4","application/jascript"],"protocols":[1,2,3,4,5,6],"api":[1,2],"linearity":1,"minduration":5,"maxduration":30}},"bids":[],"peLoadTimeout":5000,"pauseOnBlur":true,"pauseOnVisibilityChange":true,"videoAdServerUrl":"googleads.g.doubleclick.net/pead/ads?sdkv=h.3.228.0&sdki=3c4d&video_product_type=0"},"plugins.slots.jwplayer.v2.ui":{"text":{"readMore":"readmore"},"playlistUrl":"secured.dailymail.co.uk/feeds/commercial/topVideos.json","shufflePlaylist":true,"maxVideoDuration":},"plugins.slots.jwplayer.v2.ui.backgroundIme":"","pos.bvp_puff_26.editorialFallback":false,"pos.bvp_puff_26.title":"SPONSORED","pos.connatix":{"parraphIndex":4,"size":[480,410],"playerId":"c8f-d1e6-4485-be68-d4bdbf2f2b1f","margin":{"top":30,"bottom":60}},"pos.inread_player_top.parraphIndex":4,"pos.inread_player_top.watermark":{"__targeting":[{"globalContext":[{"prop":"pemeta.feT","op":"includes","value":"cwv_desktop_article_test"},{"prop":"pemeta.feT","op":"includes","value":"cwv_desktop_channel_test"}],"payload":true},{"payload":false}]},"pos.minuteMedia.configScript":"bucket1.mm-syringe.com/prod/configs/c4e65ff4-b385-d838-b9da-8cc3d8d9dfdb.js","pos.minuteMedia.moat":{"enabled":true},"pos.minuteMedia.watermark":{"__targeting":[{"browser":["chrome","edge","firefox","safari"],"globalContext":[{"prop":"pemeta.feT","op":"includes","value":"cwv_desktop_article_test"},{"prop":"pemeta.feT","op":"includes","value":"cwv_desktop_channel_test"}],"payload":true},{"payload":false}]},"pos.stickyBanner.autoRefresh":false,"pos.under-article":{"on":true,"taboola":true},"prebid.currency":{"adServerCurrency":"USD","granularityMultiplier":1,"conversionRateFile":"cdn.jsdelivr.net/gh/prebid/currency-file@1/latest.json","defaultRates":{"GBP":{"USD":1.29}}},"prebid.pubcommon":{"enabled":true},"prog.campaign.percente":{"chrome":0.7,"crios":0.7},"reconfigureSlotsEnabled":{"__targeting":{"device":["tablet"],"payload":{"remove":["sky_left_top","sky_left_bottom","sky_right_top","sky_right_bottom"]}}},"scheduler.executer":{"type":"async"},"slot.skies":{"minPeWidth":100},"sticky.billboard":{"timeAfterScroll":5000,"timeAfterVisible":3000},"sticky.billboard.forceView":true,"stickyAds":["mpu_puff_5","mpu_puff_10","mpu_puff_15","mpu_puff_20","mpu_puff_30","mpu_puff_45"],"skimlinks":{"enabled":true,"filename":"X"},"performance.async.chance":1,"amazon.priceLookup":"/abe/a9/price","taboola":{"peType":"category","enabled":true},"taboola.infiniteScroll":{"enabled":true,"start":10,"every":10,"placement":"StreamThumbnails","mode":"thumbnails-b","targetType":"mix","containerStr":"taboola-stream-thumbnails-","platform":"desktop"},"taboola.outStream":{"enabled":true,"mode":"thumbnails-mid","placement":"MidArticleThumbnails","targetType":"mix","margin":{"top":30,"bottom":60},"parraphIndex":3},"taboola.scriptDir":"dailymail-row","taboola.thumbnailChannel":{"enabled":false},"tcfv2":{"backendUrl":"cmp.dmgmediaprivacy.co.uk/gdpr/consent/persist","version":"1.3.0","uiVersion":"1.9.0","gvlVersion":120,"gvlUiVersion":120,"cvlVersion":"0.0.1","storeUserPreference":true,"reprompt":{"version":2,"chance":1}},"tcfv2.uiFile":"mailonline/index.js","trackers.syncDelay":1000,"trackers.universalIds":[{"name":"id5Id","params":{"partner":167},"store":{"type":"html5","name":"uid-id5","expires":395,"refreshInSeconds":}}],"trackers.id5":{"enabled":true,"partnerId":167},"trackers.admantx":{"endPoint":"euasync01.admantx.com/admantx/service","request":{"key":"d4d1cdf427f06ebc6ee7e0a3ffbcaecdfbfe517eca18a41d9126f88bdb16e7f0","type":"url","method":"descriptor","mode":"async","decorator":"json","filter":["admants"]}},"video.earlyBidding.enabled.chance":1,"slotDescription.billboard":{"id":"billBoard","size":[[970,250],[900,250],[728,90]],"slotTypes":["gpt","gptOOP"]},"slotDescription.gallery_billboard":{"earlyBidding":false,"size":[[728,90]],"sizeMapping":[[[1024,950],[[970,250]]]]},"slotDescription.inread_player_top":{"id":"inread_player_top","size":[[480,270],[636,1],[480,1]]},"slotDescription.leader_bottom":{"id":"leader_bottom","size":[[970,250],[900,250],[728,90]]},"slotDescription.leader_lower_middle":{"id":"leader_lower_middle","size":[[970,250],[900,250],[728,90]]},"slotDescription.leader_middle":{"id":"leader_middle","size":[[970,250],[900,250],[728,90]]},"slotDescription.leader_very_bottom":{"id":"leader_very_bottom","size":[[970,250],[900,250],[728,90]]},"slotDescription.mobile_gallery":{"earlyBidding":false,"size":[[300,250]],"unit":"mobile_gallery"},"slotDescription.mpu_comments_1":{"earlyBidding":false,"id":"mpu_comments_1","size":[[300,250]]},"slotDescription.mpu_comments_2":{"earlyBidding":false,"id":"mpu_comments_2","size":[[300,250]]},"slotDescription.mpu_home":{"id":"mpu_home","size":[[300,250]]},"slotDescription.mpu_mobile_top":{"id":"mpu_mobile_top","size":[[300,250],[350,300]]},"slotDescription.mpu_player":{"id":"mpu_player","earlyBidding":false,"size":[[300,250]],"bannerFallback":{"playerSize":[445,250],"displayTimeout":5000}},"slotDescription.mpu_puff_10":{"id":"mpu_puff_10","size":[[300,600],[300,250]]},"slotDescription.mpu_puff_15":{"id":"mpu_puff_15","size":[[300,600],[300,250]]},"slotDescription.mpu_puff_20":{"id":"mpu_puff_20","size":[[300,600],[300,250]]},"slotDescription.mpu_puff_30":{"id":"mpu_puff_30","size":[[300,600],[300,250]]},"slotDescription.mpu_puff_45":{"id":"mpu_puff_45","size":[[300,600],[300,250]]},"slotDescription.mpu_puff_others":{"earlyBidding":false,"isTemplate":true,"regex":"mpu_puff_other_(\\d+)","size":[[300,600],[300,250]]},"slotDescription.mpu_top":{"id":"mpu_top","size":[[300,250]]},"slotDescription.native_fff_accessorise":{"id":"fff-inline-accessorise-ad","size":[[632,132]]},"slotDescription.native_fff_overlay_accessorise":{"id":"fff-overlay-accessorise-ad","size":[[632,132]]},"slotDescription.puff_ad_others":{"earlyBidding":false,"isTemplate":true,"regex":"puff_ad_other_(\\d+)","size":[[300,250],[356,114],[316,114]]},"slotDescription.sky_left_gallery":{"earlyBidding":false,"size":[[120,600],[160,600]],"sizeMapping":[[[1600,0],[[300,600],[300,250]]]]},"slotDescription.sky_left_top":{"id":"sky-left","size":[[160,600],[120,600]],"conditionalSizes":{"wideSkies":true,"sizes":[[300,600],[160,600],[120,600],[300,250]]}},"slotDescription.sky_left_top.loadCondition":"isWideViewPort","slotDescription.sky_right_gallery":{"earlyBidding":false,"size":[[120,600],[160,600]],"sizeMapping":[[[1600,0],[[300,600],[300,250]]]]},"slotDescription.sky_right_top":{"id":"sky-right","size":[[160,600],[120,600]],"conditionalSizes":{"wideSkies":true,"sizes":[[300,600],[160,600],[120,600],[300,250]]}},"slotDescription.sky_right_top.loadCondition":"isWideViewPort","slotDescription.video_ad":{"id":"video_ad","size":[[300,365]]},"slots.enabled":{"gallery_billboard":{"loadingType":"immediate","loadingTrigger":"body"},"mobile_gallery":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_player":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_puff_others":{"loadingType":"lazy","loadingTrigger":"$this","loadingOffset":"6000"},"sky_left_gallery":{"loadingType":"immediate","loadingTrigger":"body"},"sky_right_gallery":{"loadingType":"immediate","loadingTrigger":"body"},"billboard":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_puff_10":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_puff_20":{"loadingType":"immediate","loadingTrigger":"#mpu_puff_20","loadingOffset":"1000"},"mpu_top":{"loadingType":"immediate","loadingTrigger":"body"},"inread_player_top":{"loadingType":"00GMT+0000(GMT)","loadingTrigger":"_","loadingOffset":0},"leader_bottom":{"loadingType":"lazy","loadingTrigger":"#leader_bottom","loadingOffset":"6000"},"leader_lower_middle":{"loadingType":"immediate","loadingTrigger":"#leader_lower_middle","loadingOffset":"6000"},"leader_middle":{"loadingType":"immediate","loadingTrigger":"#leader_middle","loadingOffset":"6000"},"leader_very_bottom":{"loadingType":"immediate","loadingTrigger":"#leader_very_bottom","loadingOffset":"6000"},"mpu_mobile_top":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_puff_30":{"loadingType":"immediate","loadingTrigger":"#mpu_puff_30","loadingOffset":"1000"},"mpu_home":{"loadingType":"immediate","loadingTrigger":"body"},"mpu_puff_15":{"loadingType":"lazy","loadingTrigger":"#mpu_puff_15","loadingOffset":"1000"},"mpu_puff_45":{"loadingType":"immediate","loadingTrigger":"#mpu_puff_45","loadingOffset":"1000"},"mpu_comments_1":{"loadingType":"delayed"},"mpu_comments_2":{"loadingType":"delayed"},"puff_ad_others":{"loadingType":"lazy","loadingTrigger":"$this","loadingOffset":600},"sky_left_top":{},"sky_right_top":{},"video_ad":{}},"__generated.modifiers.applied":["inread_player_top.plugin.modifier","mpu_comments_1.plugin.modifier","mpu_comments_2.plugin.modifier"],"__generated.rulesJs.cluster":"c","__generated.rulesJs.version":"0.5.39"};///static/mol-adverts/5.2.1/mol-adverts-facade.js(()=>{vare={8996:(e,t,n)=>{void0===n.g.adverts&&(n.g.adverts={})}},t={};functionn(o){varr=t[o];if(void0!==r)returnr.exports;vari=t[o]={exports:{}};returne[o](i,i.exports,n),i.exports}n.d=(e,t)=>{for(varoint)n.o(t,o)&&!n.o(e,o)&&Object.defineProperty(e,o,{enumerable:!0,get:t[o]})},n.g=function(){if("object"==typeofglobalThis)returnglobalThis;try{returnthis||newFunction("returnthis")()}catch(e){if("object"==typeofwindow)returnwindow}}(),n.o=(e,t)=>Object.prototype.hasOwnProperty.call(e,t),n.r=e=>{"undefined"!=typeofSymbol&&Symbol.toStringT&&Object.defineProperty(e,Symbol.toStringT,{value:"Module"}),Object.defineProperty(e,"__esModule",{value:!0})},(()=>{"usestrict";vare={};functiont(e,t){letn=arguments.length>2&&void0!==arguments[2]?arguments[2]:void0;consto=n=>String.prototype.split.call(t,n).filter(Boolean).reduce(((e,t)=>null!=e?e[t]:e),e),r=o(/[,[\]]+?/)||o(/[,[\].]+?/);returnvoid0===r||r===e?n:r}functiono(e,t,n){consto=Array.isArray(t)?t:t.match(/([^[.\]])+/g);o.reduce(((e,t,r)=>(void0===e[t]&&(e[t]={}),r===o.length-1&&(e[t]=n),e[t])),e)}n.r(e),n.d(e,{CANCEL_ABD:()=>ve,decode:()=>te,displayAdblockerDialog:()=>de,getAdIFrames:()=>ne,getAdIframeAccounts:()=>re,getBlockerDepth:()=>pe,incrementAdBlockerDepth:()=>be,insertDummyAd:()=>ie,listenToPosRendered:()=>me,onPosHasRendered:()=>fe,onPosRequest:()=>ue,registerDetection:()=>he,testWithDummyAd:()=>ae,testWithGamAbeAd:()=>se,testWithPeel:()=>ce,thereAreNoAdsOnPe:()=>ee,verifyDisplayedAdblockerDialog:()=>le}),n(8996);constr=(()=>{lete={};try{e=window.location.search.substr(1).split("&").reduce(((e,t)=>{let[n,o]=t.split("=");switch(n=decodeURIComponent(n),!0){casen.startsWith("!"):e[n.substr(1)]=!1;break;casen.endsWith("[]"):n=n.substr(0,n.length-2),e[n]=!o||decodeURIComponent(o).split(",");break;casen.endsWith("[0]"):n=n.substr(0,n.length-3),e[n]=!o||decodeURIComponent(o).split(",");break;case/\[[-+]\]$/.test(n):e[n]=[...e[n]||[],...(o||"").split(",").map(decodeURIComponent)];break;default:e[n]=o?decodeURIComponent(o):"string"!=typeofo||o}returne}),{})}catch(t){console.error("ads",t),e={}}returne})(),i=/(%[0-9A-Z]{2})+/g,s=e=>{lett;constn=";".concat(document.cookie).split(";".concat(e,"="));if(n.length>1){conste=n.pop().split(";").shift();t='"'===e.charAt(0)?e.slice(1,-1):e,t=t.replace(i,decodeURIComponent)}returnt},a="MicrosoftInternetExplorer"===nigator.appName||!(!nigator.userent.match(/Trident/)&&!nigator.userent.match(/rv:11/)),c=/^((?!chrome|android).)*safari/i.test(nigator.userent),d=(/(?:iPod|iPhone|iPad).*(?:OS)/i.test(nigator.userent),/(?!Chrom.*OPR)Chrom(?:e|ium)\/([0-9.]+)(:?\s|$)/.test(nigator.userent)),l=/Firefox\/([0-9.]+)(?:\s|$)/.test(nigator.userent),u=/Edge\/([0-9._]+)/.test(nigator.userent),f=e=>void0===e?[]:Array.isArray(e)?e:[e],m=DM.molFeClientLogger,g={},p=(e,t)=>{letn=(e.match(t)||[])[1]||"";returnn=n.split(/[._]/g),{build:parseInt(n[2]||-1,10),major:parseInt(n[0]||-1,10),minor:parseInt(n[1]||-1,10)}},h=()=>{conste=nigator.userent;g.ua=e,g.isWindows=Boolean(e.match(/WindowsPhone|iemobile|WPDesktop/i));try{g.isIPad=(Boolean(e.match(/iPad/i))||"iPad"===nigator.platform||"MacIntel"===nigator.platform&&"ontouchend"indocument)&&!g.isWindows}catch(e){g.isIPad=!1}g.isIDevice=(Boolean(e.match(/(iPad|iPhone|iPod)/i))||g.isIPad)&&!g.isWindows,g.isIPhone=Boolean(e.match(/iPhone/i))&&!g.isWindows,g.isAndroid=Boolean(e.match(/Android/i))&&!g.isWindows,g.isChrome=Boolean(e.match(/Chrome/i)),g.isFirefox=Boolean(e.match(/Firefox/i)),g.isKindleSilk=Boolean(e.match(/Silk|Kindle/i)),g.isAndroidPhone=g.isAndroid&&Boolean(e.match(/Mobile/i)),g.isAndroidTablet=g.isAndroid&&!Boolean(e.match(/Mobile/i)),g.isMobile=g.isIDevice||g.isAndroid||g.isWindows,g.isAndroidStock=g.isAndroid&&!g.isChrome&&!g.isFirefox&&!g.isKindleSilk;try{g.isIDevice?(g.mobileName=e.match(/(iPad|iPhone|iPod)/i)?e.match(/(iPad|iPhone|iPod)/i)[0]:"iPad",g.mobileVersion=p(e,/OS((?:\d+[._]?)+)/i)):g.isAndroid?(g.mobileName="Android",g.mobileVersion=p(e,/Android((?:\d+[._]?)+)/i)):g.isWindows?(g.mobileName="WindowsPhone",g.mobileVersion=p(e,/WindowsPhone((?:\d+[._]?)+)/i)):(g.mobileName=null,g.mobileVersion={build:-1,major:-1,minor:-1})}catch(e){m.logger.error("Failedtoparsemobilenameandversion",e),g.mobileName="unknown"}};try{h(),g.isAndroidStock&&(m.logger.debug("ExecutingAndroidStockbrowserOrientationbugfix"),window.addEventListener("orientationchange",(()=>{conste=document.querySelector("meta[name=viewport]");if(e){constt=e.getAttribute("content");e.setAttribute("content","width=,initial-scale=1.0,minimum-scale=1.0,maximum-scale=1.0,user-scalable=0"),setTimeout((()=>{e.setAttribute("content",t)}),0)}})))}catch(e){m.logger.error("Errorparsinguserent",e)}constb=()=>g.isAndroidTablet,v=()=>g.isIPad,y=()=>g.isMobile,w=(A={browser:S((function(e){switch(e){case"chrome":returnd;case"edge":returnu;case"ie":returna;case"firefox":returnl;case"safari":returnc;default:return!1}})),cookie:S((function(e){returnObject.entries(e).some((e=>{let[t,n]=e;returnn.includes(s(t)||"")}))})),device:S((function(e){switch(e){case"tablet":returnv()||b();case"desktop":return!y()}})),iOSVersion:S((function(e){let{min:t,max:n}=e;const[o]=function(){try{if(/iP(hone|od|ad)/.test(nigator.platform)){conste=nigator.appVersion.match(/OS(\d+)_(\d+)_?(\d+)?/);return[parseInt(e[1],10),parseInt(e[2],10),parseInt(e[3]||0,10)]}}catch(e){console.error(e)}return[-1,-1,-1]}();return(void0===t||t=o)})),timeRange:S((function(e){let{end:t,start:n}=e;consto=newDate,r=t&&P(t)o;return!r&&!i})),globalContext:S((function(e){let{prop:o,op:r,value:i}=e;if("includes"===r){conste=t(n.g,o);return"string"==typeofe?e.includes(i):f(e).includes(i)}}))},e=>{for(consttinA)if("function"==typeofA[t]&&!A[t](e[t]))return!1;return!0});varA;functionS(e){returnt=>void0===t||(Array.isArray(t)?t.some(e):e(t))}functionP(e){const[t,n,o]=e.split(":").map(Number),r=newDate;returnr.setHours(t),r.setMinutes(n),r.setSeconds(o),r}constI=function(){lete=newSet;if(r.adsDebug)e=newSet(((!0===r.adsDebug?"all":r.adsDebug)||"").toLowerCase().split(","));else{constt=r["ac.adsDebug"]||n.g.adverts.config&&n.g.adverts.config.adsDebug;"boolean"==typeoft?e=newSet(["all"]):Array.isArray(t)&&(e=newSet(t.map((e=>e.toLowerCase()))))}returne}(),E=I.has("all"),C=()=>{};functionx(e){lett=arguments.length>1&&void0!==arguments[1]?arguments[1]:["%c".concat(e),M()],n=arguments.length>2&&void0!==arguments[2]?arguments[2]:0;consto=E||I.has(e.toLowerCase()),r=o?console.log.bind(console,...f(t)):C;returnr.debugName=e,r.label=t,r.enabled=o,r.log=i("log"),r.trace=i("trace"),r.debug=i("debug"),r.info=i("info"),r.warn=i("warn"),r.error=i("error",!0),r.table=o?s:C,r.extend=o=>{const[r,...i]=f(t),s=n+1;returnx(e,["".concat(r,"%c").concat(o),...i,M(s)],s)},r;functioni(e){letn=arguments.length>1&&void0!==arguments[1]?arguments[1]:o;returnn&&"function"==typeofconsole[e]?console[e].bind(console,...f(t)):C}functions(){r("Table:"),console.table(...arguments)}}functionM(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:0;return"display:inline-block;color:#fff;background:hsl(214deg100%".concat(35+10*e,"%);padding:1px4px;border-radius:3px;")}functionj(e,t){if(e===t)returne;constn=typeoft;if("undefined"===n)returne;consto=Array.isArray(t);if(null===t||"string"===n||"number"===n||"boolean"===n||"function"===n||!o&&"object"===n&&null!==t&&t.constructor!==Object)returnt;if(null===e)returnj(void0,t);constr=typeofe,i=Array.isArray(e);if(n!==r)returni?e:"function"===r&&"object"===n?(Object.entries(t).forEach((t=>{let[n,o]=t;e[n]=o})),e):"undefined"===r?o?j([],t):"object"===n?j({},t):t:"undefined"===n?e:t;if(i){constn=e.length,o=t.length;letr;for(r=0;r{constt="true"===e;return"false"===e||t?t:e})(e):parseFloat(e))(n))}))};functionL(e){constt=e.id&&document.getElementById(e.id);if(t)returnt;constn=document.currentScript||N(document.querySelectorAll("*[id^=".concat(e.pos,"]script")))||N(document.scripts);if(!n||"BODY"===n.parentNode.nodeName)thrownewError("Cannotfindcurrentscriptfor".concat(e.pos));returnn.parentNode}functionN(e){returne[e.length-1]}Object.entries(n.g.adverts.config).forEach((e=>{let[t,n]=e;try{if(function(e){return"object"==typeofe&&!(null==e||!e.__targeting)}(n)){conste=function(e){let{__targeting:t}=e;return(f(t).find(w)||{}).payload}(n);void0!==e&&k(t,e)}elsek(t,n)}catch(e){console.error(e)}})),n.g.adverts.config=D,function(){conste=JSON.parse(localStore.getItem("mol-ads-control-panel-config")||"null");"object"==typeofe&&null!==e&&function(){for(vare=arguments.length,t=newArray(e),n=0;nj(e,t)))}(D,e)}(),O();constR="mol.ads.cmp.tcf.cache",B=["getTCData","hasUserConsentedToAll","hasUserDissentedToAll","getPurposesByVendorMap","getConsentDegree","getValidTCData","consentedVendors","getStoredRepromptVersion"],q=location.search.match(/adsDebug=[^&]*tcfv2/)?function(){returnconsole.info(...arguments)}:()=>{},W=[],F=window;letV=!1;q("creating");constz=localStore.getItem(R);letJ={};z&&(J=JSON.parse(z));letG=0;constU={},H=(e,t)=>{constn=J.getTCData,o=G++;q("addingprovisionallistener:",o),U[o]={},W.push(["addEventListener",2,(e,n)=>{constr=e.listenerId;U[o]?(U[o].realListenerId=r,U[o].listenerId=r,t({...e,listenerId:o},n)):q("ignoringeventcozalreadyremovedlistener:",{listenerId:o,realListenerId:r})}]),n&&t({...n,listenerId:o,eventStatus:"tcloaded",cached:!0},!0)},X=(e,t)=>{constn=e[3];q("removingprovisionallistener:",n);consto=U[n];if(!o)returnq("unknownlistener:",n),voidt(!1);constr=o.realListenerId;deleteU[n],r&&W.push(["removeEventListener",2,e=>t(e),r]),t(!0)};const$=e=>{document.body?e():n.g.requestAnimationFrame((()=>{$(e)}))},K=()=>newPromise($);classQextendsError{constructor(e){super("Exceeded".concat(e))}}constZ=e=>newPromise((t=>setTimeout(t,e)));functionY(e){lett=arguments.length>1&&void0!==arguments[1]?arguments[1]:10,n=arguments.length>2&&void0!==arguments[2]?arguments[2]:Number.MAX_SAFE_INTEGER;consto=Date.now(),r=i=>Promise.resolve(e()).then((e=>{if(e)returne;if(Date.now()-or(i+1)))}thrownewQ(n)}));returnr(0)}functionee(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:document;return!ne(e).length&&!e.querySelector(te("/npm.bet.tljo.fobcmfe"))}functionte(e){lett="";for(letn=0;n0&&void0!==arguments[0]?arguments[0]:document;returne.querySelectorAll(te("jgsbnf\\je_>#hpphmf`bet`jgsbnf`0#^"))}constoe=newRegExp(te("_hpphmf`bet`jgsbnf`0)]e,*0"));functionre(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:document;constt=ne(e),n=[];for(lete=0;e{constt=()=>{e(r)};n?requestAnimationFrame(t):setTimeout(t,200)}))}functionse(e){let{maxGAMAdRenderTime:t}=e;constn=x("creative-detection"),o=newPromise((e=>{constt=te("`en`bcf\v"),n=(o=window,r="messe",i=o=>{varr,i;null!==(r=o.data)&&void0!==r&&null!==(i=r.startsWith)&&void0!==i&&i.call(r,t)&&(n(),e(o.data.slice(t.length)))},o.addEventListener(r,i,s),()=>o.removeEventListener(r,i,s));varo,r,i,s}));n("awaitingforbody"),n("bodyfound");constr=document.createElement("iframe");returnr.src=te("iuuqt;00tfdvsfqvcbet/h/epvcmfdmjdl/ofu0hbnqbe0bey@jv>ebjmznbjm/vl0bcf't{>2y2'd>75'u>qpt&4Ebcf"),r.style.height="1px",r.style.width="1px",document.body.appendChild(r),n("waitingforiframe..."),(async(e,t)=>{constn=[],o=[];returnawaitPromise.race([Z(e),Promise.all(t.map((e=>e.then((e=>n.push(e))).catch((e=>o.push(e))))))]),{errors:o,results:n}})(t,[o]).then((e=>{let{results:t}=e;consto=!t.length;returnn(te(o?"be!cmpdlfs!efufdufe":"op!be!cmpdlfs!efufdufe")),[o]})).finally((()=>{document.body.removeChild(r)}))}functionae(e){returnie(e).then((e=>{constt=getComputedStyle(e),n=ee()&&"none"===t.display;returne.remove(),[n]}))}functionce(e){let{peelTimeout:t}=e;constn=document.createElement("script"),o=newPromise((e=>{n.addEventListener("load",(()=>{e(!document.getElementById(te("set3k4553dC3wTfe")))})),n.addEventListener("error",(()=>{e(!0)}))}));n.src=te("0qffm/kt");constr=Date.now();returndocument.head.appendChild(n),o.then((e=>(document.head.removeChild(n),Date.now()-r>t?[!1,{late:!0}]:[e,{late:!1}])))}functionde(){returnnewPromise((e=>{const{DM:t}=n.g;null==t||t.later("bundle",(()=>{t[te("npmGfBecmpdlfsEjbmph")].init(),e()}))})).then(le)}functionle(){returnY((()=>function(e){window.getSelection().removeAllRanges();constt=document.createRange();t.selectNode(e),window.getSelection().addRange(t);constn=window.getSelection().toString().trim();returnwindow.getSelection().removeAllRanges(),n}(document.body).indexOf(te("Xf!tff!uibu!zpv(sf!vtjoh!bo!be!cmpdlfs"))>-1),300,2e3)}functionue(e){lett=!1;n.g.adverts.queue.push({scope:te("poBeSfrvftu"),data:()=>{t||(t=!0,e())}})}functionfe(e){lett=!1;n.g.adverts.queue.push({scope:te("poBeSfoefsfe"),data:n=>{t||(t=!0,e(n))}})}functionme(){lete=!1;returnfe((t=>{e=t})),()=>e}constge="bcfefqui";functionpe(){returnNumber(localStore.getItem(ge))}functionhe(e){constt=Number(localStore.getItem(ge)||"0"),n=e?t+1:0;returnlocalStore.setItem(ge,n.toString()),n}functionbe(){he(!0)}constve=Symbol("dbodfm!bce");functionye(){conste="x-loc=",t=document.cookie.indexOf(e);if(-1===t)return;constn=document.cookie.indexOf(";",t);if(-1===n)return;consto=document.cookie.substring(t+e.length,n);returno.length>0&&"none"!==o.toLowerCase()?o:void0}constwe=Y((()=>{vare;returnnull===(e=window.RTA)||void0===e?void0:e.ids}),300,3e3).then((e=>e.user||e.visit?{rta:{user:e.user,visit:e.visit}}:{})).catch((()=>({}))).then((e=>{vart,o;const{PeCriteria:i={},pemeta:s={}}=window;return{account:"mol",adsFreeUser:null===(t=(o=n.g).isAdFreeEntitled)||void0===t?void0:t.call(o),articleId:i.articleId,channel:i.channel,configVersion:_("__generated.commit.sha"),bundle:"facade",cmVersion:_("__generated.rulesJs.version"),cmCluster:_("__generated.rulesJs.cluster"),device:i.device,embed:!0,event_type:"bidmax",geo:i.geo,isMobile:i.isMobile,isTablet:i.isTablet,office:ye(),peType:i.peType,peViewId:i.peViewId,referrer:document.referrer,sponsored:i.sponsored,subchannel:i.subchannel,timeAtSend:0,type_version:2,url:location.href,version:r.bidmax||s.adsBundleVersion||"absent",...e}}));letAe={};functionSe(e){Ae={...Ae,...e}}functionPe(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:{};constt=!!_("bidmax.dispatcher.useCurrentUrl");returnwe.then((o=>newPromise(((r,i)=>{consts=newXML,a=t?"".concat(n.g.location.origin).concat(n.g.location.pathname):_("bidmax.dispatcher.url","//crta.dailymail.co.uk");s.open("POST",a,!0),s.addEventListener("abort",i),s.addEventListener("error",i),s.addEventListener("load",r),s.setRequestHeader("Content-Type","text/plain"),s.send(JSON.stringify({...o,...Ae,...e,timestamp:Date.now()}))})))).catch((e=>console.error(e)))}constIe="mol.ads.mvt.tests",Ee="probabilityDraw",Ce=e=>{let[t,n]=e;return{...n,name:t}},xe=function(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:"";constt=e.match(/^(-?[0-9.]+)\s*(%?)$/);if(t){lete=parseFloat(t[1]);return"%"===t[2]&&(e/=100),e}return0},Me=function(e,t){letn=arguments.length>2&&void0!==arguments[2]?arguments[2]:{};consto="".concat(Ie,".").concat(t.name,".").concat(Ee),r=t.size||t.scenarios.reduce(((e,t)=>{let{size:n}=t;returne+xe(String(n))}),0),i=je(Math.min(Math.max(0,xe(String(r))),1));lets=Number(n[o]);returnisNaN(s)&&(s=Math.random(),n[o]=s.toString()),s0&&void0!==arguments[0]?arguments[0]:{};consto=e("reconfigureSlotsEnabled",{remove:[]}).remove;if(n("slotstoremove",o),o.length){constr=e("slots.enabled",{});for(consteofo)deleter[e];n("slots.enabled",r),t("slots.enabled",r)}}if({ccpa:{enabledIfDissent:!0},gdpr:{enabledIfDissent:!0},init:_e},x("plugin-registry")("registeringplugin:","reconfigureSlotsEnabled"),~_("plugins.enabled",[]).indexOf("reconfigureSlotsEnabled")&&_e(),~_("plugins.enabled",[]).indexOf("mvt")&&function(e){const{tests:t,scenarios:o,selectedScenarios:r}=function(e,t){if(!n.g.adsMVTResults){consto={},r={},i=Object.entries(t).map(Ce).filter((e=>e.scenarios)).map((e=>({...e,scenarios:Object.entries(e.scenarios).map(Ce)}))),s=i.reduce(((t,n)=>{consti=n.scope||"pe",s="pe"===i?o:"session"===i?sessionStore:localStore,a=function(e,t){letn,o=arguments.length>2&&void0!==arguments[2]?arguments[2]:{};constr="".concat(Ie,".").concat(t.name,".selected"),i=o[r],s=t.scenarios.find((e=>e.name===i));if(Me(e,t,o)){if(s)n=s;else{consti=t.scenarios.filter((e=>{let{size:t}=e;returnt}));if(t.scenarios.length===i.length){conste=Math.random();leto=0;n=t.scenarios.find((t=>{let{size:n}=t;returno+=n,je(o)>e}))}elsei.length&&e.warn('Test"'.concat(t.name,'"hassomescenarioswithsizeandsomewithout,fallingbacktoglobalscopesize')),n=t.scenarios[Math.floor(Math.random()*t.scenarios.length)];o[r]=n.name}returnn}}(e,n,s);returna?(r[n.name]=a.name,[...t,a]):t}),[]);n.g.adsMVTResults={peStore:o,selectedScenarios:r,scenarios:s,tests:i}}returnn.g.adsMVTResults}(x("mvt").extend("facade"),e),i=t.map((e=>[e.name,r[e.name]])).filter((e=>{let[,t]=e;returnt})).map((e=>e.join("="))).join(",");((e,t,n)=>{consto=(e=>e.map((e=>(Te('Fromscenario"'.concat(e.name,'",loadingconfig:'),e.config||{}),e.config||[]))).reduce(((e,t)=>e.concat(t)),[]).filter((e=>e)).reduce(((e,t)=>(Object.entries(t).forEach((t=>{let[n,o]=t;e[n]=o})),e)),{}))(n);Object.entries(o).forEach((e=>{let[n,o]=e;t(n,o)}))})(0,k,o),O(),Se({mvt:i})}(_("mvt.tests",{})),function(e){for(consttofe)document.documentElement.classList.add("molads_".concat(t,"_","on"))}(Object.keys(_("slots.enabled",{}))),function(){conste=PeCriteria.geo;e&&document.documentElement.classList.add("".concat(e.toLowerCase(),"_country"))}(),De=_("plugins.enabled",[]),!s("smart-banner")&&Array.isArray(De)&&~De.indexOf("smartBanner")&&(window.PeCriteria&&(window.PeCriteria.isTablet||window.PeCriteria.isMobile)||function(){conste=nigator.userent;try{return(Boolean(e.match(/iPad/i))||"iPad"===nigator.platform||"MacIntel"===nigator.platform&&"ontouchend"indocument)&&!Boolean(nigator.userent.match(/WindowsPhone|iemobile|WPDesktop/i))}catch(e){return!1}}()||function(){conste=/(Windows\s*[a-zA-Z]*)\s+([^;\s)]+)/i.exec(nigator.userent);returne&&"windowsnt"===e[1].toLowerCase()&&parseFloat(e[2])>=6.4}())&&!/^?:\/\/t\.co(\/.*)?$/.test(document.referrer)&&!/[?&]source=newzit\.app/.test(location.search)&&document.documentElement.classList.add("smart-banner-enabled"),n.g.isAdFreeEntitled&&n.g.isAdFreeEntitled()&&document.documentElement.classList.add("molads_ads_free"),n.g.adverts.queue=n.g.adverts.queue||[],n.g.adverts.addToArray=function(e){n.g.adverts.queue.push(["FacadeQueueItem","addToArray",[e,L(e)]])},n.g.adverts.initEmergencyRules=ke("initEmergencyRules"),n.g.adverts.initSlots=ke("initSlots"),n.g.adverts.addFBRemarketingPixel=ke("addFBRemarketingPixel"),n.g.adverts.on=ke("on"),n.g.adverts.getRendered=()=>[],n.g.adverts.addTaboolaPosition=ke("addTaboolaPosition"),n.g.adverts.setSupportedSlots=ke("setSupportedSlots"),n.g.adverts.requestAdByGoogle=n.g.adverts.requestGoogleAd=ke("requestAdByGoogle"),n.g.adverts.stopRefreshingAds=ke("stopRefreshingAds"),n.g.adverts.forceRefreshAds=ke("forceRefreshAds"),n.g.adverts.appendToInfiniteList=ke("appendToInfiniteList"),_("abe.detection.enabled")){constt=x("abe");Se({abdEnabled:!0});consto={delay:_("abe.detection.delay",0),maxGAMAdRenderTime:_("abe.detection.maxGAMAdRenderTime",3e3),sessionDepth:_("abe.detection.sessionDepth",1/0),testMethodName:_("abe.detection.testMethod","none"),peelTimeout:_("abe.detection.peelTimeout",1e3),dummyId:_("abe.detection.dummyId","tlz.sjhiu"),testMethod:()=>Promise.resolve([!1])};t("options:",o);constr=function(t){constn=[te("uftuXjuiEvnnzBe"),te("uftuXjuiHbnBcfBe"),te("uftuXjuiQffm")].includes(t.testMethodName)?e[t.testMethodName]:t.testMethod;returnt.sessionDepth>0?function(e){constt=e.testMethodName,n=pe();returnnhe(t),o=()=>{t=!1,window.removeEventListener("unload",n),he(t)};window.addEventListener("unload",n),fe(o),K().then((()=>e.testMethod(e))).then((e=>{let[n]=e;t=n})).catch((e=>{o(),console.error(e)}))}(e),ve):(window.addEventListener("unload",(()=>{pe()>0&&be()})),Pe({payload:{abdReason:t,adblocker:!0,adblockerDepth:n,method:"multi-pe",adIframes:ne().length,adIframeAccounts:re()}}).then((()=>({blocked:!0,reason:t}))))}({...t,testMethod:n}):function(e){constt=e.testMethodName,n=me();returnK().then((()=>function(e){const{resolve:t,promise:n}=function(){lete,t,n=!1;return{promise:newPromise(((n,o)=>{e=o,t=n})),reject(t){n||(n=!0,e(t))},resolve(e){n||(n=!0,t(e))}}}(),o=((e,t)=>{letn,o;constr=function(){for(varr=arguments.length,i=newArray(r),s=0;s{n=void0,e(...o),o=void0}),t)};returnr.callNow=function(){n&&(clearTimeout(n),n=void0);for(vart=arguments.length,r=newArray(t),i=0;ie.testMethod(e))).then((e=>{let[o,r]=e;returnPe({payload:{...r,abdReason:t,adblocker:o&&!n(),method:"one-pe",posRenderedDuringABD:n(),adIframes:ne().length,adIframeAccounts:re()},type:"abd"}).then((()=>[o,r]))})).then((e=>{let[n,o]=e;return{blocked:n,reason:t,...o}}),(e=>(console.error(e),{blocked:!1,reason:t})))}({...t,testMethod:n})}(o);r!==ve?r.then((({blocked:e,reason:o,...r})=>(t("result:",{blocked:e,reason:o,...r}),n.g.adverts.queue.push({scope:te("beCmpdlfsEfufdujpo"),data:{adblocker:e,reason:o,...r}}),e))).then((e=>e&&_("abe.displayDialog",!1)&&de().then((e=>e&&Pe({type:"abe"}))))).catch(console.error):t("cancelled")}functionke(e,t){return(...o)=>(n.g.adverts.queue.push(["FacadeQueueItem",e,o]),t)}~_("plugins.enabled",[]).indexOf("tcfv2")&&(n.g.adverts.tcfv2Installed||(n.g.adverts.tcfv2Installed=!0,functione(){constt=F.document;if(!F.frames.__tcfapiLocator)if("interactive"===t.readyState||"complete"===t.readyState){constn=t.createElement("iframe");n.style.display="none",n.name="__tcfapiLocator",t.body.appendChild(n),V&&(t.removeEventListener("readystatechange",e),V=!1)}else"function"==typeoft.addEventListener?(t.addEventListener("readystatechange",e),V=!0):setTimeout(e,5)}(),F.__tcfapi=function(){lete;for(vart=arguments.length,n=newArray(t),o=0;o3&&2===parseInt(n[1],10)&&"boolean"==typeofn[3]&&(e=n[3],"function"==typeofr&&r("set",!0));break;case"ping":"function"==typeofr&&r({gdprApplies:e,cmpLoaded:!1,cmpStatus:"stub"});break;default:if(B.length){if("addEventListener"===i)returnH(0,r);if("removeEventListener"===i)returnX(n,r)}if(~B.indexOf(i)){n[3]&&q("cachemethodcalledwithargument:",n[3]);conste=J[i];if(void0!==e)returnq("returningcachedvaluefor",i),voidr(e,!0)}q("queueing",i),W.push(n)}},F.addEventListener("messe",(function(e){constt=e&&e.source;if(!t||"function"!=typeoft.postMesse)returnvoid(t&&"function"!=typeoft.postMesse&&q("Messeevent.source.postMesseisnotafunction,bailing"));constn="string"==typeofe.data;leto=e.data;if(n)try{o=JSON.parse(e.data)}catch(e){return}if("object"==typeofo&&o.__tcfapiCall){conste=o.__tcfapiCall;window.__tcfapi(e.command,e.version,((o,r)=>{consti={__tcfapiReturn:{returnValue:o,success:r,callId:e.callId}};t.postMesse(n?JSON.stringify(i):i,"*")}),e.parameter)}}),!1),n.g.adverts.updateCache=asyncfunction(e,t){if(e.tcString.length){conste=B.map((e=>newPromise((o=>{n.g.__tcfapi(e,2,((n,r)=>{if(t("caching",e),r){constt=JSON.parse(localStore.getItem(R))||{};t[e]=n,localStore.setItem(R,JSON.stringify(t))}elset("errorcachingmethod:",e);o()}))}))));awaitPromise.all(e)}}))})()})();varcurrentChannelTwitterFollow='';DM.later('bundle',function(){DMS.Nigation.init({facebookAppId:'',facebookChannelUrl:'',channel:'',hostName:''});});//scripts.dailymail.co.uk/static/mol-adverts/5.2.1/embedded.jsadverts.addFBRemarketingPixel();DM.later('bundle',function(){DM.HomePe.init({id:'homePeCover',enableGeoChoice:true});}); HomeU.K.NewsSportsU.S.ShowbizAustraliaFemailHealthScienceMoneyVideoTrelShopDailyMailTVRussia-UkraineWarCovid-19JoeBidenKamalaHarrisDonaldTrumpUSEconomyPrinceHarryMeghanMarklePuzzlesMyProfileLogoutLoginPrivacyPolicyFeedbackMonday,Jun27th202211AM81°F2PM86°F5-DayForecast HomeUpdated:23:08EDTAdvertisement'Iwastiredofbeingtired':CNNhostChristiPaulsaysshe'spartoftheGreatResignation'asshetearfullyannouncesonairthatshehasquitthenetworkandplanstomovetoOhiowithherfamilyCNNweekendanchorChristiPaultearfullyannouncedthatshewasquittingthenewsnetworkduetoburnoutandmovebacktoherhomestateofOhiotoliveasimplerlifewithherfamily.Paul,originallyfromBellevue,Ohio,saidherdecisioncameaftershewasn'tabletoseeherparentsforayearcoupledwiththedemandingscheduleofaweekendanchorthatmeantgettingintoworkat1amonSaturdaysandSundays.ShesaidthatthegrindoflivinginAtlantaandanchoringtheweekenddeskhadputastrainonherfamilytothepointwhereshehadtomakeachoicebetweenthetwo.'Ilovethesepeople,Ilovethisplace,'shesaidofCNNandhercoworkers.'AndIamsotired.I'msoexhausted.IjustcouldjustnotbewhoIneedtobeformyfamily.I'mtiredofbeingtired.'ShesaidthatshemadethedecisioninJanuarytoreturntotheBuckeyestatewhereshewilltakeanon-airjob.Paulsaidshewouldannouncehernewjobnextweek.193470comments1videoDM.isLoggedIn=false;DM.userData='';varsearchTerms='';/**/varrefererHost="direct";if(document.referrer){vardocReferrerHostMatches=newRegExp("([^/]*)/.*").exec(document.referrer);/*Checkjusttobesafe*/if(docReferrerHostMatches){vardocReferrerHost=docReferrerHostMatches[1];refererHost=docReferrerHost;}}//logintracking(1)DM.peEvents.listen(DM.peEvents.PE_LOGIN_BUTTON_CLICKED,function(obj,event,pars){if(pars.action==='loggingIn'){document.cookie="attempting_login=true;path=/";}});varpemeta={environment:'production',clientSegmentation:{"segments":{"a":{"weight":10},"b":{"weight":10},"c":{"weight":80}},"shuffleNumber":2,"defaultSegment":"default"},comscoreClientId:'',comscoreNsSite:'master',domain:'dailymail.co.uk',channel:'/ushome',channelId:'561',subChannel:'/ushome',subChannel2:'',contentType:'home',articleTitle:'',articleId:'',articleVersionNumber:'',internalSearchTerms:searchTerms,loggedInStatus:(DM.isLoggedIn?'LoggedIn':'LoggedOut'),galleryTitle:'',galleryId:'',threadTitle:'',threadId:'',userId:DM.userId,partnerSite:'',publishedDate:null,updatedDate:null,authorName:'',authorsIds:[],authorsShortNames:[],errorUrl:'',serverDate:newDate(63),url:'D=g',referringSubDomain:refererHost,topics:[],inlineLinks:'',peName:'/ushome/home',products:'',bundleLocation:'/static/gunther/17.14.4',bundleVersion:'17.14.4',syncBundleLocation:'/static/mol-fe/static/mol-fe-sync-bundle/6.12.0-pr-319.2216',syncBundleVersion:'6.12.0-pr-319.2216',asyncBundleLocation:'/static/mol-fe/static/mol-fe-async-bundle/6.32.0',asyncBundleVersion:'6.32.0',videoBundleLocation:'/static/videoplayer/6.14.0',videoBundleVersion:'6.14.0',adsBundleLocation:'/static/mol-adverts/5.2.1',adsBundleVersion:'5.2.1',feT:'fe_ukraine',appVersion:'5.365.0',configVersion:'2572',textBased:false,isDecorator:''==='true',isFeatureArticle:''==='true',webPush:{"baseEndpoint":"hulkprod.anm.co.uk/api/web-push-notification/","hostname":"dailymail.co.uk","promptFrequency":"7d","promptEnabled":true},wordCount:'0:0:0:0:0:0:0',relatedWithThumbs:true,renderPlatform:'desktop',isTopicLiveBlog:false};//logintracking(1)window.feT='fe_ukraine';if(document.cookie.replace(/(?:(?:^|.*;\s*)attempting_login\s*\=\s*([^;]*).*$)|^.*$/,"$1")==="true"&&DM.isLoggedIn){document.cookie="attempting_login=false;path=/";pemeta.registrationEntry='SuccessfullyLoggedIn';}DM.setPeMetadata(pemeta);/*************DONOTALTERANYTHINGBELOWTHISLINE!**************/DM.peEvents.fireEvent(DM.peEvents.PE_RENDER_STARTED,DM.getPeMetadata());if(nigator.appVersion.indexOf('MSIE')>=0)document.write(unescape('%3C')+'\!-'+'-')window.molMVTest=(window.molMVTest?window.molMVTest+',':'')+pemeta.feT;DM.platformConfig={features:{}};Object.assign(DM.platformConfig.features,{});if(MobileUtils.isIPhone()){document.documentElement.className+='is_iphone';}elseif(MobileUtils.isIPad()){document.documentElement.className+='is_ipad';}PeCriteria=window.PeCriteria||{};PeCriteria=window.PeCriteria||{};PeCriteria.containsVideo=true;StatenIslandshopperdescribesmomentshewasstanding'shouldertoshoulder'withRudyGiulianiashewashitbygrocerystoreworkerandsaysthestrikewas'sohardthatshefeltit' ShopperDritaRugov(top)wasstandingnexttoRudyGiuliani(bottom)whenhewasallegedlyhitbyanemployeeofaShopRitegrocerystoreonStatenIsland.Rugovsaidtheformermayorhadreedtoposeforaphotographwhenhewassuddenlyaccostedandhitsohardthatshefeltit.Giulianiwasatthestorecampaigningforhisson,Andrew,whoisrunningforgovernorofNewYork,whenhewasslappedontheback.Eyewitnessessaytheattackerwasapparentlya39-year-oldworkeratthestore. 'IwasdoingmynormalusualgroceryshoppinghereinShopRitewhenIhappenedtoseetheformerMayorGiulianiinthere,'Rugovsaid.'Iwentuptohimtosay"hello"andIwantedtotakeaphotowithhim.Iwasgettingreadytotakethisphotowhenagentlemanthatworksherehithimopenhandedlyintheback,closertohisneckandsaidtohim"Heyyouf***ingscumb!"' Surveillancefootecapturedbyin-storecamerasappeartoshowtheso-calledattackwaslittlemorethanataponthebackbutGiulianiappearedtohefeltthingsdifferentlyandwentonNewYorkradiostationWABCdescribinghowhewasfortunatenottohebeenseriouslyinjured,orevenkilled.28195comments1videoDidRupertMurdochbreakupwithJerryHallbytext?MediamogulmightheendedhismarrieviadigitalmesseamidconcernsoverhersmokinghabitRupertMurdochmightheendedhismarriewithJerryHallviatextmesse,ithasbeenclaimed.22630commentsClickthroughtodayinpicturesBenx27;ssonSamuel,10,x27;dingsx27;dadx27;sLamborghiniBenLizzoKatieUpto40THOUSANDArmyNationalGuardtroopshen'tbeeninoculatedainstCOVIDandmaylosetheirjobsasdeadlineforvaccinationloomsthisweekUpto40,000ArmyNationalGuardsoldiersacrossthecountry-orabout13percentoftheforce-henotyetbeenvaccinatedainstCOVID.TheynowheuntilThursday.45381comments1videoNewYorkCityPriderevelersrunscreamingafterfireworksaremistakenforgunfireinManhattanparkwhilestampedeistriggeredatSanFranciscoeventafterfightsbreakoutalongparaderouteALSOsparkingmassshooterconfusion PoliceinNewYorkCityandSanFranciscoonSundaysaidthatreportsofshootingsatPrideparadesintheircitieswerefalsealarms.comments8videos1shareNYCandSFPriderevelersrun:fireworks,fightmistakenforshootingGoogletellsU.S.employeestheycanrelocatetostateswhereabortionislegalaslawmakersinTexaspromiseswiftlegalactionainstcompaniesthatfundout-of-stateabortionsGooglehastolditsworkersintheU.S.thattheywillbeallowedtomovetoanotherstatewithouthingtojustifyafterRoevWadewasoverturned3commentsshareGoogletellsemployeestheycanmovetostateswhereabortionislegalBamMargera'goesmissingfromrehabclinicinFlorida'AIN-justtwoweeksafterfirstfleeingfacilityBamMargerahasfledarehabclinicinFloridaforthesecondtimethismonth,TMZreported.771347comments3videosBenAffleck'ssonSamuel,10,BUMPShisLamborghiniintoaBMWafterhisdadlethimbehindthewheelduringoutingwithJenniferLopezatLAautodealershipBenAffleck'ssonSamuel,10,wasbehindthewheelofaLamborghiniinLosAngelesonSundaywhenitmadecontactwithaBMWvehiclethatwasparkedbehindit.Samuelhadaccompaniedhisfather,49,andAffleck'sgirlfriendJenniferLopez,52,totheluxuryvehicledealership777Exotics,TMZreported.Thegroupwaslookingatdifferentvehicles,theoutletreported,whenAffleckpermittedhissontogetintothedriver'sseatofayellowLamborghinithathadtheenginerunning.869comments1videoTrumpSHOULDbecriminallycharged,nearly50%ofUSvoterssayinnewpoll:AdamSchiffwarnsDOJitwouldbemakinga'politicaldecision'ifitfailstoinvestigateex-presidentoverJanuary6ThelatestsurveyfromCBSNewssuggeststhatapluralityofAmericansthinkTrumpwasdirectlyinvolvedinacriminalplottoundermineUSdemocracy.2.4kcomments2.1ksharesTrumpSHOULDbecriminallychargedforJan.6,46%ofvoterssay:PollSouthCarolinamanwinsmorethan$100,000afterusinglotterystrategyhesawonrealityTVshowTheunidentifiedwinner,whochosenottobenamed,saidhedidn'tinitiallyknowhowtoplaythelotteryandonlywonthegrandprizeafterhisseventhweekofinvesting$25inlotterytickets.122253commentsDisgracedTodayshowhostMattLauerandhisex-wifeAnnetteRoquereunitefor18-year-olddaughterRomy'shighschoolgraduationinEastHampton DisgracedTodayShowhostMattLauerandhisex-wifemodelAnnetteRoquereunitedattheirdaughter'shighschoolgraduationintheHamptonsthisweekend.Theformercouple proudlywatchedtheir18-year-olddaughter,Romy,receiveherdiplomaSundayduringhercommencementceremonyinEastHampton.Roquecarriedabouquetofflowers,presumablyforRomy,intotheevent.ProuddadLauerwasseenstandingupinthecrowd,apparentlytakingphotosofRomy,asshecrossedtheste.LauerandRoquedivorcedin2019after21yearsofmarrie.Theirseparationcameafterthe oncehighestpaidTVhostinthecountry,earning$25millionayear,wasoustedfromNBCin2017 followingallegationsofsexualharassmentintheworkplace.Thecouplesharesthreechildren:daughterRomyandsonsJack,21,and Thijs,15.233726commentsTopGun:Mericksoarspast$1Battheglobalboxofficeandbecomesthehighest-grossingfilmofTomCruise'scareerTomCruise'shighly-anticipatedfilmTopGun:Merickachievedanotherimpressivemilestoneattheglobalboxofficethisweekendasit crossedthe$1billionmark.13k358comments2videos'We'renotgoingtostandforthisinthiscity':Furyasfive-month-oldbabygirlbecomeslatestChicohomicidevictimafterwomanopensfireoncarascrimespiralsoutofcontrolintheWindyCity CeciliaThomas,aninfant,wastrelinginacarwithherfatherwhenshewasshotintheheadin Chico'sSouthShoreneighborhoodFridaynight.Shewastakentoahospitalwhereshedied.comments15sharesFive-month-oldbabygirlbecomeslatestChicohomicidevictimThreepeoplearedeadandfourmoreinjuredafterAmtraktraincrashesintoacarinCaliforniaThreepeoplewerekilledandtwoothers-includingonechild-wereinjured afteranAmtraktraincollidedwithacarinBrentwood,California.Thetwowhowereseriouslywoundedwererushedtothe JohnMuirMedicalCenterafterthecrashonSundayafternoon,accordingtoABCNews.Itisnotyetclearhowmanypassengerswereaboardatthetime.EastContraCostaFireDepartmentofficialstoldthenetworkthey'dalreadybeencalledouttothattraincrossingtwicelastyearbecauseitdoesnotheatrafficguard.448commentsBrianLaundrie'smotherwrotehimaletterwhereshe'offeredtoassisthim'andwrote'burnafterreadingthis'ontheenvelope,lawyerforGabbyPetito'sfamilyclaimsPatrickRiley,thelawyerforGabbyPetito'sparentssaysthatBrianLaundrie'smotherwrotealettertohersonofferingtohelphimafterhestrangledhisgirlfriendduringaVanLifetouroftheU.S.224comments1video196sharesBrianLaundrie'smom'offeredtoassisthim,'PetitolawyersaysAustralianclimateprotesterbringsSydneytraffictoaHALTbylockingherselftohersteeringwheelwithabikelock-ascopsfranticallytryandstemdisruptionsfrommassdemonstrationsBlockadeAustraliahesharedtheirplanstocause'massdisruptions'inSydneyonMondaymorningasleadersdistributedlegaladvicetomembersaheadoftheweek-longprotest3videos961sharesChaosasclimateprotesterskickofftheirweek-longattackonSydneyROEVWADE:LANDMARKRULINGISOVERTURNED Howrude!FullHousestarJodieSweetinisshovedtothegroundbyLAPDofficersduringabortionrightsprotestonfreewayActressJodieSweetinwasshovedtothegroundbypoliceofficersduringanabortionrightsprotestmarchinLosAngelesovertheweekend.Sweetin,bestknownforplayingStephanieTanneron'FullHouse,'alsodescribesherselfonhersocialmediaprofilesasanactivist,waswithalargegroupofprotestersmarchingonafreeway,oneofthemanydemonstrationsthattookplaceinresponsetotheU.S.SupremeCourtoverturningRoev.Wade.VideopostedtoinstramshowsSweetin,dressedallinblacktotingamegaphone,closeLAPDofficerswhohadformedalineacrossthefreeway,whensuddenlytheofficersshoveherbackcausinghertostumbleoverthecurbandintothefreewaywhereagroupofprotesterscaughther.SweetintoldTMZthatshe'sOKfollowingtheincidentandsaidshewasproudofthehundredswhoshowedupfortheprotests.3comments1video370sharesFullHousestarJodieSweetinshovedtothegroundduringprotestsRudyGiulianiisslappedinthebackatStatenIslandgrocerystorebyemployeeangryaboutRoev.Wadebeingoverturned:Workercalledhima"f**kingscumb"andyelledhewas"killingwomen"'RudyGiulianiwasattackedbyasupermarketworkeronStatenIslandonSunday.GiulianiwasatShopRitecampaigningforhisson,Andrew,whenhewasslappedonthebackofthehead.7.6k1.5kcomments1videoShedecides:WomengoonnationwideSEXSTRIKEinprotestatSCOTUSoverturningRoevWadeaspro-choicemarchescontinueacrossAmericaandvandalstargetpro-lifecenters Pro-choicesupportersarethreateningtodenymensexandcallsforasexstrikearegainingmomentumonlineaspeoplecontinuetoprotestSupremeCourt'sdecisiontooverturnRoev.Wade.15k6.6kcomments1videoSamuelL.JacksonderisivelycallsSCOTUSjustice'UncleClarence'andaskshimhowhefeelsaboutoverturningLovingv.Virginia-the1967rulingthatdeclaredstatebansoninterracialmarrieareunconstitutional SamuelLJacksondubbedSupremeCourtJusticeClarenceThomas'UncleClarence'afterhedefendedthedecisiontooverturnRoevWadeandsuggestedusingthelogictooverturnotherlandmarkdecisions.ThetermisanapparentreferencetotheUncleTomcharacterinabolitionistHarrietBeecherStowe'snovelwhoiswidelyseenasasubservientsle,andJacksonusedittoaskThomashowhefeelsabouttheLovingvVirginiadecisionthatallowsforinterracialmarrie.Thomas,74,isnowinaninterracialmarriewithhiswife,Virginia.ButinhisopinionsupportingtheSupremeCourt'sdecisiontooverturnRoevWadeonFriday,Thomascalledforhiscolleuesto'reconsider'otherlandmarkSupremeCourtcasesthatusethesamelegalbasisasRoevWade,liketheonesthatallowforcontraceptionandgaymarrie.Still,ThomasnotablydidnotmentiontheLovingcase.41635comments1videoAOCsuggestsconservativeSCOTUSjusticesshouldbeIMPEACHEDbecause'theylied'aboutRoev.Wadeinconfirmationhearings:ProgressivesaysGOP-ledstates'abortionbans'willkill'womenandblastsDemocratsforhinga'weakstrategy'TheNewYorkprogressivealsotookaimatherparty'sleadersforsendingoutcampaignfundraiserssoonaftertherulingwasissuedonFriday.2kcomments1video124sharesAOCblastsDemocrats'messingonRoev.WadebeingoverturnedMostAmericansfearSCOTUSwilllimitbirthcontrolandsame-sexmarrieafteroverturningRoe,pollshows: ArkansasGOPgovernorstandsbyhisabortionbanwithoutrapeorincestexceptionsbutvowscontraceptionis'notgoingtobetouched'Morethaneightin10peoplesaidthingsinAmericatodayaregoingbadlyinthesurveytakenjustaftertheSupremeCourtoverturnedabortionprotections,whilejust19percentsaidtheopposite.3981.4kcomments2videos'F***America':GreenDayStarBillieJoeArmstrongsayshe'srenouncinghisU.S. citizenshipduringLondonconcertinwakeofSCOTUSoverrulingRoeGreenDaystarBillieJoeArmstrongproclaimed'f**kAmerica'andclaimedhewas'renouncinghiscitizenship'inwakeoftheSupremeCourt'sdecisiontooverturnfederalabortionprotections.Armstrong,50,madethedeclarationduringaFridaynightconcertinLondon,tellingtheaudience:'There'stoomuchf***ingstupidintheworld.'HealsotoldthecrowdhewasgoingtomovetotheUK,astatementthatwasmetwithroaringapplause.Armstrong'sremarkscameasprotestseruptedacrosstheU.S.aftertheconservative-majorityhighcourtvotedtooverturnthelandmark1973caseRoev.Wade,whichheldthatabortionfellundertheconstitutionalrighttoprivacy.TheAmericanIdiothitmakerhasrepeatedlyusedhismusicalplatformtoprotestpoliticiansandallegedinjustices.Atashowearlierthismonth,heperformedinfrontofabackdropthatread'f**kTedCruz'inanefforttotakeaimattheGOPsenatorfromTexas. HepreviouslycalledoutDonaldTrumpfor'holdinghalfthecountryhoste'anddevotedanentirealbumtocriticizingGeorgeW.Bushand theIraqWar.Armstrong,apassionatebackerofPresidentJoeBiden,alsoreportedlyfiledpaperworklastyeartorunasaRepublicaninthe2024presidentialelection.2.7k4.9kcomments2videosMadonnain'deepdespair'abouttheoverturningofRoev.Wadeandis'scared'forherfourdaughters:'Wehelessrightsthanagun'The63-year-oldQueenofPop-whowasraisedRomanCatholic-includedsnapsofherselfwitheldestdaughtersLourdesandMercy270comments3videos852sharesMadonnaisin'deepdespair'abouttheoverturningofRoev.WadeHalleBerryemotionallyspeaksoutabout'bulls***'SupremeCourtrulingoverturningRoev.Wade:'I'moutred!'TheClevelandnativeurgedforpeopletobandtogether'andNOTacceptthis,'adding,'Wecan'tjustpostaboutitandtalkabout-wemustDOSOMETHINGaboutit!'200comments2videos1.4ksharesHalleBerrysaysshe's'outred'over'bulls***'SupremeCourtruling'F**ktheSupremeCourt!'LordeslamscontroversialRoevWaderulingonabortionduringGlastonburyperformanceasleotard-cladsingertellsfans'it'sgoodtobeback'Lordetoldfansitwas'goodtobeback'asshe kickedoffhersetonthePyramidSteatGlastonburyFestivalonSundayinSomerset.Thesinger,25,lookedsensationalasshedebutedhergorgeousnewblondehair,whileslippinghertonedphysiqueintoatightmauveleotard.Shealsoshouted,'F**ktheSupremeCourt,'overitsrulingonRoevWade,whichformerlyprotectedapregnantwoman'sfreedomtoheanabortion.958comments3videos1.7ksharesLordeslamsRoevWaderulingonabortionduringGlastonburygig'Somanywomenandsomanygirlsaregonnadiebecauseofthis':OliviaRodrigocallsoutthefiveSCOTUSjusticeswhovotedtooverturnRoeonGlastonburysteandthenduets'F**kYou'withLilyAllen OliviaRodrigocalledouttheSupremeCourtjusticeswhovotedtooverturnRoev.Wadeduringherperformanceatthe GlastonburyFestival.ShethendedicatedLilyAllen's'F**Kyou'tothem.1.1kcomments1video542sharesOliviaRodrigonamechecksSCOTUSjusticeswhovotedtooverturnRoeMichiganDemocratGovernorGretchenWhitmerdodgesquestiononpro-abortiongroupthatpromised'nightofre'followingSupremeCourt'sdecisiontooverturnRoev.WadeWhitmerwaspressedtwiceonwhethershehadanyconcernsafterpro-abortiongroupJane'sRevengewasaccusedofvandalizingapropertyhousingacongressman'sofficeandpro-lifegroup.188comments2videos2sharesMichigangovernordodgesquestiononviolencefrompro-abortiongroup'Mybabybrotherneverhadachance':FoxNewsanalystGiannoCaldwell'syoungestsiblingChristian,18,isshotandkilledinChicoNEWGiannoCaldwellhasrevealedthathis18-year-oldbrotherwasshotandkilledonthesouthsideofChico,inashootingwhichlefta25-year-oldwomanand31-year-oldmaninjured.Noarrestshebeenmade.'WhatI'mlookingforrightnowisdetailsfromthepolicetodiscoverwhoitwasthatmurderedmybrother,'saidCaldwell.'Thenoneday,wheneverthey'reoutofjail-ifit'snotforlife-maybetheycanturntheirlivesaroundandgivehopetootheryoungmenifthereisanyhopeofrehabilitatingthem.Iwouldneverwanttoseeanystreetjusticeorviolenceainstthepeoplewhoevenmurderedmylittlebrother.ButIdowantthembroughttojustice.'commentsshareFoxNewsanalyst'steenebrotherisshotandkilledinChico Ex-NFLstarAlexSmithrevealshissix-year-olddaughterSloaneneeded10-hourbrainsurgeryafterdoctorsfound'averyraremalignanttumor'SloaneSmith,six,wasdinosedwitharareformofbraincancerafterbeing'rushedtotheERwithstroke-likesymptoms.'Thechildisnowbacktoher'trueform'aftera10-hoursurgeryatStanfordHealth.45comments3.2ksharesEx-NFLstarAlexSmith'sdaughter,6,neededbraincancersurgeryTrisScottisslammedbyparentsofAstroworldvictim,9,afterflaunting$5.5millionBugattiVeyronChiron TrisScottisgettingslammedbythefamilyoftheyoungestAstroworldtredyvictimEzraBlount,forflauntinghis$5.5mcar,withtheattorneysayinghismoneycouldhebeenspentonsafety.386comments2videos2.6ksharesTrisScottslammedbyAstroworldvictim'sparentsfor$5.5MBugattiQAnonconspiracytheorycreator'Q'returnstoonlinemesseboardforthefirsttimeintwoyearswithcrypticpost:'Shallweplayagameoncemore?''Q,'theenigmaticleaderofQAnon-theTrump-backingmovementthatbelievesaglobalSatan-worshipingcannibalisticchildkidnappingringcontrolstheworld-hasreemergedaftertwoyears.FollowersrecognizedthepostfromtheoriginalQ'suniquesignatureontheforum.Althoughhisidentityhasneverbeenrevealed, linguisticresearchersbelieveQiscomputerentrepreneurRonWatkins,thefounderoftheInternetchatspace.DisinformationresearchersbelievethatQ'sreemergencecoincideswiththeU.S.SupremeCourt'srecentcontroversialdecisiontooverturnRoevWade,whichwasmetwithnationwideprotests119880comments2videosBidenlinksarmswithMacronasG7leadersposeforshowofunityatbenchmadefamousbyObamaandMerkelin2015,andsaystheRoedecisiondidnotcomeupinanymeetingsG7leadersenjoyedalightheartedmomentattheendofdayoneoftheirAlpinesummit,posingforaphotographatthebenchmadefamousbyBarackObamaandAngelaMerkelin2015.448comments5videos20sharesBidenandG7leadersposeinshowofunityatObama-MerkelbenchG7leadersunveil$600bninfrastructureplantotackleChineseinfluence:Bidencommits$200billioninfundingforsolarfarms,vaccineplantsandcommunicationslinksaroundtheworldTheplans,unveiledonSundayattheG7summitinGermany,aredesignedasanalternativetoChina'smassiveBeltandRoadinitiativewhichhaswoninfluenceforBeijinginthedevelopingworld.811comments4videos369sharesBidenunveils$200billiontotakeonChinaaroundtheworldInflation-bustingNYcouplewithNINEchildrenwhoowntheirownhomeandhezerodebtspendjust$364amonthbybuyinginbulk,shoppingwithrestaurantsupplystoresandgrowingtheirownvegetablesAfrugalfamilywithninechildrenwhoowntheirhomeinupstateNewYork,hezerodebtandspendjust $364amonth,saythey'recopingwiththenation'srecord-highinflationdoingwhatthey'vealwaysdone:notspendingmoney.TheShillitofamilyofBurntHill,NewYork,growsfruitsandvegetablesintheirgardenandtheirgroceryshoppingislimitedtobuyinginbulk,buyingmarkeddownitems,andshoppingdirectlywithrestaurantsupplystores.Americanshestartedchangingtheirspendinghabitsasinflationishittingpocketshardandeconomistswarnarecessionisinevitable.Butfrugalfamilies,likeArtandJanelleShillito,whoheninechildren,es2monthsto19years,saytheyheafewtacticsthatcouldhelpAmericanssesomecash.'Itdoesn'taffectusasmuchbecauseofthewayweshop,'ArtShillitotoldtheWallStreetJournal.'Peoplefindwhatwedointerestingbutwhentheyfindouthowinvolveditis,they'renotinterested.Theywantacoupleeasysolutions.'2261.4kcomments1videoGhislaineMaxwellwasplacedonsuicidewatchaftershereportedthatjailstaffhadthreatenedhersafety:Sextraffickercouldfaceatleast30yearsbehindbarsforhelpingJeffreyEpsteinabuseyounggirlsGhislaineMaxwellreportedthatBrooklynjailstaffthreatenedhersafety,promptingemployeestoplaceheronsuicidewatch,prosecutorssaidonSunday.2comments1video3.8ksharesGhislaineMaxwellonsuicidewatch'afterjailstaffthreatenedher'FrenchathleteWilfriedHappioisASSAULTEDjust20minutesbeforehisraceandisleft'coughingupblood'...butsensationallybecomesthenational400mhurdleschampionwhilewearingeyepatch FrenchathleteHappio,settocompeteinthenationalmeetinCaenonSaturday,waswarmingupwhenhewasviolentlyassaulted,the23-year-oldtrackstar,takingseveralpunchestotheface.57comments456sharesWilfriedHappioASSAULTEDbeforerace-butbecomes400mhurdleschampSevenpeopletakingpartinfishingcompetitionareairliftedtosafetyaftertheir39-footboatwasstruckbylightningandlostpowerleingthemstranded100milesoffthecoastofFloridaTheUSCoastGuardcametotherescuetosesevenpeoplewhobecamestrandedwhentheirboatwasstruckbylightingaround100milesoffofClearwater,Florida,intheGulfofMexico.ThegroupwasparticipatingintheOldSaltFoundationfishingtournamentwhenthestrikehappened.Theboat'sownertoldDailyMail.comthattheCoastGuardrescuedthegrouparoundtwohoursafterthestrike.Theboat'sownersentoutanelectronicposition-indicatingradiobeacon,aidingtherescue.Noneofthegroupsufferedseriousinjuries.Theboat'sownertoldDailyMail.comthathefeels'tiredandblessed.Godisrealandkeepsandeyeonallofusandgladallmyfriendsandfamilyareokay.'comments1video1shareSevenpeopleairliftedtosafetyafterboatwasstruckbylightningAirlinesshiftblameonwidespreadflightdelaysonFAAandsaysunderstaffingattheencyis'crippling'airtrafficalongtheEastCoastastheywarnofcancellationsoverJulyFourthweekend AirlinesareaccusingtheFAAofnotrevealingitsplansforthebusyholidayseason,justaweekendaheadoftheJulyFourthholiday.TrelonJuly4thisexpectedtosetnewpandemicera-highs.166comments1video36sharesAirlinesaimtoshiftblameforflightproblemstoFAAaheadofJuly4TurkishpoliceclashwithLGBTQsupportersandnewsphotographeratbannedIstanbulPridemarch-withofficersarrestingmorethan100peopleInthelatestclashbetweenthegaycommunityinIstanbulandpolice,LGBT+supportersandanewsphotographerweredetainedbyofficersdressedinriotgear.12comments1video21sharesTurkishpoliceclashwithLGBTQsupportersandnewsphotographerMajorLeueBase-brawl!CarnebreaksoutduringAngelsvsMariners'gamewithbothmanersandSIXplayersdismissedafterpunchesarethrown-causinggametobedelayedby18minutesTheSeattleMarinersandtheLosAngelesAngelsengedinalengthyfull-teambrawlinthesecondinningsonSundayaftertensionsovertwodaysofinsidepitchesboiledover.ThescufflestoppedandstartedtwicebeforeAngelscloserRaiselIglesiascamebackouttotheemptyfieldtothrowatubofsunflowerseedsandanotherbucketofgumontotheinfieldwhilescreamingattheumpires.ThreeofthefirstfourhittersinSeattle'slineup-JesseWinker,JulioRodriguezandJ.P.Crawford-werethrownout,whileAngelspitchersAndrewWantz,IglesiasandRyanTeperaweregiventheirmarchingorders.7860commentsJournalistdumpedbyMartinShkrelirevealsshemissedmarriecounselingwithherhusbandtosecretlyvisitthePharmaBroinprison ChristieSmytheleftherhusbandandherjobforMartinShkreli,whodumpedherfrombehindbars,ayearandahalflater.OnSundayshecontinuedherdefenseofhischaracter.37comments3sharesJournalistdumpedbyShkrelimissedmarriecounselingtoseehim300bottlesofCognacrecoveredfromshipsunkinWWIcouldfetch$10,000EACH:FrenchshipmentonSwedishsteamerboundfortsaristRussiaendedupatbottomoftheBalticSeaafterGermanU-boatstrikeAhoardofDeHaartman&CocognacrecoveredfromtheshipwreckofSwedishsteamerKyrosacenturyafteritsankonitswayto tsaristRussiaisgoingonsalefornearly£8,000abottle.111comments34shares300Cognacbottlesrecoveredfromwreckcouldfetchnearly£8KEACHDon'tmentionthesmut!WarningtoQueenoverDenmark'spornindustrybeforeHerMajestymetmonarch ButbeforeshemetMargretheIIduringtheQueenofDenmark'sstatevisittotheUKin1974,herMajestywasadvisednottomentionthenation'sreputationastheporn'capitalofEurope'.54comments13sharesQueentoldnottomentionDanishpornindustrybeforemeetingmonarchSheddingthatpuppyfat!ShihTzuwhoweighed30lbsandcouldbarelywalkshedsmorethanathirdofherbodyweightQueenie,anine-year-oldShihTzu,weighedawhoppingtwostoneandfourpounds-abouttheweightofamid-sizedmicrowe-whenshecameintoaWelshanimalcharity'scareayearo.105comments916sharesShihTzuwhoweighedover2stshedsmorethanathirdofbodyweightJustinBieberisseenfortheFIRSTtimesincegettingdinosedwithRamsayHuntsyndromeashetouchesdowninLosAngeleswithwifeHaileyPopstarJustinBieberwasseenforthefirsttimesincebeingdinosedwiththerareneurologicaldisorderRamsayHuntsyndromewithhiswifeHaileyearlierthismonth.OnSunday,theGrammywinner,28,appearedinhighspiritsashereturnedtoLosAngleswithhissupermodelspouse,25,afterenjoyingsomequalitytimetogetheronaprivateislandintheBahamasashefocusedonhisrecovery.Afterdeboardingaprivatejet,theGhostsingerstayedclosetohiswifeastheysatside-by-sidewhilebeingdrivenoffthetarmacwithalltheirluggeintow.21comments4videos1.1ksharesJustinBieberseenforFIRSTtimesinceRamsayHuntsyndromedinosisNowPrinceCharles'charityfacesprobeover$3.1mincashfromQatarisheikh-asUK'sCharityCommissionconsiderswhetheritwillassistintheinvestigationIthasemergedaformerQatariprimeministerdonated£2.5milliontothePrinceofWales'sCharitableFund.Threedonationsofnearly£900,000werestuffedincarrierbsandaholdall.8comments32sharesPrinceCharlescharityfacesprobeover€3mincashfromQatariSTEPHENGLOVER:PrinceCharleseitherdemonstratedastonishingnaivetyorthearroganceofsomeonewhodoesn'tbelieveheisconstrainedbyconventions...There'sjustonewordforhisjudgment-appallingSTEPHENGLOVER:YesterdaywasaverygooddayindeedfordiehardrepublicanswhoyearntoreplacethemonarchywithanelectedPresident.Coulditreallybetrue?Alas,itwas.55comments20sharesSTEPHENGLOVER:There'sonewordforCharles'judgment-appallingFourdead-includingachild-andasmanyas70peopleinjuredafterstandcollapsesatbullfightingringinColombia Afullthree-storeysectionofwoodenstandsfilledwithspectatorscollapsed,throwingdozensofpeopletotheground,accordingtoimesbroadcastonsocialmedia.'Therearefourpeopledeadatthemoment-twowomen,amanandachild,'thegovernorofTolimadepartment,JoseRicardoOrozco,toldlocalradioaftertheincidentinthecentralcityofElEspinal.'Thereareabout30peopleseriouslyinjured...that'sapreliminaryreport,'Orozcosaid,notingthatemergencypersonnelwerestillevacuatingthewoundedtoareahospitalsfortreatment.LocalcivildefenseofficialLuisFernandoVelezsaidtheydidnotknowhowmanypeoplewerestillburiedinthedebris,butnotedthatthesectionofstandswasfullwhenitcollapsed.Theevent,wheremembersofthepublicfaceoffwithsmallbulls,waspartofcelebrationssurroundingtheSanPedrofestival,themostpopularintheregion.8.2k384comments3videosLAPDofficer,32,wasbeatentodeathbycolleuesinsimulatedmobattacktrainingexercisewherehesufferedcatastrophicspinalinjury,hismotherclaimsinwrongfuldeathlawsuit ShirleyHuffmanclaimsherson,LAPDcopHoustonTipping,was'beatentodeath'inatrainingexercisemeantto'simulateamob.'ShehasfiledawrongfuldeathsuitainstthecityofLA.565comments3.7ksharesLAcop'wasbeatentodeathinsimulatedmobattacktrainingexercise'Mum-of-twohasonlyJUSTdiscoveredwhyweuseabbreviationslike'1st'and'4th'-andthousandsweresurprisinglycluelesstooThousandsofpeopleheadmittedtonotknowingasimplegrammarruleafteramum-of-twopostedanow-viralvideoonTikTok.54comments24sharesMumjustdiscoveredwhyweuseabbreviationslike'1st'and'4th'WARINUKRAINE BeastfromtheEast!PanickingPutin'callsupOBESE280lbsretiredgeneral,67,toleadforcesinUkraine'afteratleast14topRussiancommandersarekilledorfired  PutinhascalledanobesegeneraloutofretirementtotakecommandofforcesinUkraineafteryetanotherroundofpurgesoftopcommandershaslefthim'scrapingthebarrel'.The20stoneGeneralPel,67,hasbeensummonedfromhiscomfortableretirementintheMoscowsuburbsandtoldtodonhisspecially-madearmyfatiguesandgotothefrontlinesofeasternUkraine.HewillnowtakechargeofRussianspecialforcesoperatingintheregionaftertheunit'sformercommanderwasseriouslyinjuredinanartillerystrike.AveteranoftheSovietUnion'sill-fatedinvasionofAfghanistaninthe1980s,hewasa40yearveteranofRussia'sspecialforces,buthaslethimselfgoconsiderablysinceretirementfiveyearso.Heisunderstoodtoeatfivemealsadayandpolishitalloffwithalitreofvodka.Sincecomingbacktotheservice, hehashadtohehisuniformspeciallymadeandheneedstoweartwosetsofbodyarmourtoensurehistorsoisprotected.AseniorintelligencesourcelastnighttoldtheDailyStarSunday:'Putinisnowscrapingthebarrel.'Mostofhisbestandbattle-hardenedseniorcommandershebeenkilledorinjuredfightinginUkrainesoheisresortingtosendingsecondrateofficerstothefrontwhodon'tlastverylong.4.5k6.5kcomments1videoPutinrainsterrorontheinnocent:Seven-year-oldgirliscarriedfromtheruinsofherKyivhomeafteritwasblastedinmissilestrikewhileshesleptAseven-year-oldgirlwaspicturedbeingpulledoutofthewreckeofherKyivhomeafteraRussianairstrike.Theunidentifiedchildwasfastasleepwhenthebombsfelltoday387comments3videos59sharesPutinrainsterror:Girl,7,iscarriedfromKyivruinsafterstrikeBidenannouncesG7willbanRussiangoldinresponsetoUkrainewarasWesttriestotightenfinancialnoosearoundVladimirPutinPresidentJoeBidenannouncedonSundaythattheUnitedStatesanditsG7allieswillbanimportsofRussiangoldinanotherattempttocutoffVladimirPutin'sfundingforhiswarinthUkraine. 913comments1video994sharesBidenanouncesG7willbanRussiangoldinresponsetoUkrainewarPutin'sblue-lightdashtotheKremlin:PoliceconvoyracesRussianleadertomysterylate-nightmeetinginMoscowafterreeingtosharenuclear-capablemissileswithLukashenko Putin'sspokesmandidnotdenythelatenightdashtotheKremlin,butruledoutthepurposebeingacrisismeetingoftopofficials.HealsodeniedthatPutinwastomakeanimmediateemergencystatement.682comments2videos295sharesPoliceconvoyracesPutintomysterylate-nightmeetingintheKremlin'It'smoreoftheirbarbarism':BidenslamsRussianattackonKyivafterpromisingthatVladimirPutinwillnotdivideG7leadersastheykeeppressureonforitsinvasionofUkrainePresidentJoeBiden onSundayslammedRussia'sattackonKyivas'barbarism'asheworkedtoholdWesternleaderstogetherainstVladimirPutin.624comments2videos71sharesBidenslamsRussianattackonKyivas'barbarism'RookieNYPDcopwhowasfilmedgivinglieutenantalapdanceatstaffChristmaspartyisurgedbyfansofhersultryInstramsnapstostartanOnlyFansaccount'andmakemillions'VeraMekuli,26,therookieNYPDofficercaughtonvideogivinghersuperioralapdanceduringandepartmentChristmaspartyisbeingencouredtostartanOnlyFansaccount.Theofficer,whowassuspendedfromtheforceinMayforallegedlydrunkenlyberatingaNewJerseyStateTrooper,mostrecentlypostedbikinipicsandselfiesinatight-fittingdressonInstramdramaticallyincreasingherfollowing.She'srackedup17,800followersforherheily-filtered,clee-baringphotosandseveraldaysoshewascheeredontomonetizeherattractionontheOnlyFanssubscriptionserviceforedbyentrepreneurialpornstars151comments1video1shareLap-dancingNYPDcopurgedbyfanstostartanOnlyFansaccountThat'ssmashing!It'saWimbledondreamcometruefortennisplayer,26,whobeatcancerasababy The26-year-old,fromGreatWakering,Essex,fulfilsadreamtodaywithhisWimbledonsinglesdebutainstSwitzerland'sHenriLaaksonen.2comments97sharesWimbledondreamcometruefortennisplayerwhobeatcancerasababy TentsgoupatWimbledon!Drovesoftennisfanssetupcampoutsideclubaheadindesperatehopeofsecuringticketsforfirstdayoftournamenttomorrow ThrongsofidtennisloverswerespottedatWimbledontodayreadytosecureticketsfortomorrow'sopeningmatches,withsomemakingthemselvesquiteathomeoutsidetheclub.3comments1video51sharesThingsarealreadyTENTSatWimbledon!DrovesoffanssetupcampDECIDEDLYTHEBESTPRODUCTSFROMDAILYMAILExploreourotherrecommendationsSLAYtheMrs.KourtneyKardashianBarkerwaywith20apparelitemstogetyouapoppunklegendlikeTrisBarker20clothingitems&accessoriesyouneedtoattracttheTrisBarkertoyourKourtneyKardashianAppleFINALLYmadeaniPadthatDESTROYShomePCsforcasualusers—checkoutouriPadAirIN-DEPTHreviewiPadAir(5thgeneration)review:Finally,aniPadforeveryoneSespaceandreleasetheburdenofclunkyuprightvacs—thebestcordlessstickvacuumsarelightweight,sespace,andheplentyofattachmentsThebestcordlessstickvacuumswillsetyoufreefromcordsandbulky,heycleanersGoingtothebeach?BEATthesandandHEATwiththebestbeachblankets!Thebestbeachblanketstokeepyousunkissedandsand-freeStaycoolandgetbettersleepwiththesesheetsBeatthesummerheatandkeepsweat-freewiththebestcoolingsheets15waystospendyourstaycationsoGASPRICESdon’truinyoursummerbudget15thingstomakeyourstaycationcozyandluxuriousPartyHARDERthanAndrewW.K.—thesummersocialessentialstogetapartygoingEverythingyouneedfortheperfectsummerbashExploreourotherrecommendationsAffiliatedContentMostSharedRightNowLast30MinutesShedecides:WomengoonnationwideSEXSTRIKEinprotestatSCOTUSoverturningRoevWadeaspro-choicemarchescontinueacrossAmericaandriotersinPortlandgoonrampe15.1ksharesBeastfromtheEast!PanickingPutin'callsupOBESE280lbsretiredgeneral,67,toleadforcesinUkraine'after'mostofhisbestandbattle-hardenedseniorcommandersarekilled'inwar 4.3kshares'F***America':GreenDayStarBillieJoeArmstrongsayshe'srenouncinghisU.S. citizenshipduringLondonconcertinwakeofSCOTUSoverrulingRoe2.6ksharesSamuelL.JacksonderisivelycallsSCOTUSjustice'UncleClarence'andaskshimhowhefeelsaboutoverturningLovingv.Virginia-the1967rulingthatdeclaredstatebansoninterracialmarrieareunconstitutional 270sharesEXCLUSIVE:DisgracedTodayshowhostMattLauerandhisex-wifeAnnetteRoquereunitefor18-year-olddaughterRomy'shighschoolgraduationinEastHampton 178sharesAdvertisement 2,000-year-oldtortoisediscoveredinPompeii ruins     BingSiteWebEntersearchterm:SearchDM.later('bundle',function(){DM.has('p-710-bing','bingSearchBox');});FollowDailyMailSubscribeDailyMailFollow@dailymailFollowDailyMailFollowMailOnlineFollowDailyMailDM.later('bundle',function(){DMS.Puff.init({twitter:{newsUS:{text:'@DailyMail',account:'DailyMail'},newsAU:{text:'@DailyMailAU',account:'DailyMailAU'}}});});DM.later(['bundle','DOM_READY'],function(){DM.molFeRemovePuffWhitespace.init();});  FemailTodayBenAffleck'ssonSamuel,10,appearstobackLamborghiniintoBMWduringoutingwithdadandJenniferLopezatLAautodealership KatieHolmesandnewboyfriendBobbyWootenIIIengedinPDAatweddingintheHamptons:'Theylookedveryinloveanddidn'tcarewhosaw' KhloeKardashiansizzlesintinyhotpinkbikinifromherclothingbrandGoodAmericanKhloeshowedoffhercurvyphysiqueLizzoisavisioninplungingnyfeathergownwiththigh-highsplitalongsideTarajiP.HensonandCynthiaErivoontheBETAwardsredcarpet JussieSmollettattendsBETAwardsandtalks'expandingmy"Empire"'...asTwitterroaststheconvictedhatecrimehoaxer 'F***you,SupremeCourt':JanelleMonáehasbluntwordsandcoarsesignlangueforUShighcourt EXCLUSIVE:MattLauerandhisex-wifeAnnetteRoquereunitefortheirdaughterRomy'shighschoolgraduationinEastHampton  JustinBieberisseenfortheFIRSTtimesincegettingdinosedwithRamsayHuntsyndromeashetouchesdowninLosAngeleswithwifeHailey Thesecrettoyouthfullookingskin?Snailslime!EmilyRatajowskiandthousandsofAmazonshopperslovethisskinserumcontainingsnailsecretions-andit'snowonly$21Promoted 2022BETAwards:JazmineSullivanwinsthefirstawardoftheeveningfor BestFemaleR&B/PopArtist TarajiP.Hensonstunsinasparklingsilverdressonthe2022BETAwardsredcarpetinLATheEmpireactresshasbeenhonoredbythemediacompanyAdvertisementBamMargera'goesmissingfromrehabclinicinFlorida'AIN-justtwoweeksafterfirstfleeingfacility BlacChynawearsplunginggolddresswithspikesatthe2022BETAwardsinLosAngeles KhloeKardashianshowsofftonedtummyincroptopandleggingsingymmirrorselfies...aftersisterKimrevealsshewidened'vinaarea'ofSKIMSbodysuitatherrequest Canyouloseweightwithoutcountingcalories?Thisnewappsayseverythingyouassumedaboutweightlossiswrongandmatchesyouwithacoachforlastingresults-se30%nowPromoted RachelLindsaydisplayshertonedlegsinastunningorangeminidressontheredcarpetattheBETAwards JussieSmollettreturnstotheBETAwardsforfirstredcarpetappearancesinceservingjustsixdaysinprisonforfakingahatecrimeattack DeFrancoandwifeAlisonBrieshareasweetkissastheenjoythesunshineinLosAngelesDeandAlisonlookedcomfortableastheystrolledtolunchDidRupertMurdochbreakupwithJerryHallbytext?Mediamogulmightheendedhismarrieviadigitalmesse,itisclaimed  JanelleMonáewearsdaringdresswithsee-throughsheerskirtandblackrosefeatureatBETAwards ArianaGrandesharescutethrowbackcliptoInstram:'Whatdoyouthink,I'mPeterPanorsomething?' AdvertisementMadonnain'deepdespair'abouttheoverturningofRoev.Wadeandis'scared'forherfourdaughters:'Wehelessrightsthanagun' HeidiKlumrocksall-denimensembleassheandhusbandTomKaulitzpackonthePDAduringaromanticstrollinNYC AndyCohenstartsoffSundaymorningwithhisdaughterLucyashesharesevenmoreprecioussnapsofthenewestadditiontohisfamily  PrincessMaryandPrinceFrederikriptheireldestsonChristian,16,outofprestigiousDanishschoolamidhorrificbullyingandsexualassaultallegations CharliXCXputsonaVERYanimateddisplayintightblackbraandmedievalleatherminiskirtassheflashesherrearduringGlastonburygig WillFerrellspottedforthefirsttimeonthesetoftheupcomingBarbiemovieinLosAngeles...rockingapinklook FullHousestarJodieSweetinisshovedtothegroundbyLAPDduringabortionrightsprotestmarchinLosAngeles  KendallJennerenjoysthesinglelifewhileouttolunchwithBFFFaiKhadraafterposingNUDEpicturebythepoolaftersplitfromDevinBooker RebelWilsonstripsdowntoabikiniassheenjoysromanticholidayinCorsicawithnewgirlfriendRamonarumabeforepairposeforacuteselfieontheirprivatejetHaileyBiebershowsoffhertonedabsinabluebikiniassheenjoysatriptoTheBahamaswithhusbandJustin Advertisement'There'stoomuchstupidintheworld':GreenDayStarBillieJoeArmstrongsays'f***America'ashesaysheisrenouncinghiscitizenshipatLondonconcert SamuelL.JacksonderisivelycallsSCOTUSjustice'UncleClarence'andaskshimhowhefeelsaboutoverturningLovingv.Virginia PriyankaChoprabaresskininsexyswimsuitassheenjoysromanticgetawaytoTurksandCaicoswithhusbandNickJonasinidyllicsnaps HalleBerryemotionallyspeaksoutabout'bulls***'SupremeCourtrulingoverturningRoev.Wade:'I'moutred!' CarrieJohnsonandBrigitteMacronleadthestylishG7wivesasproskiertakesthemonafternoonhikearoundLakeFerchenseeinGermanyaftertheirgroupenjoyedconviviallunchonitsshores 'F**ktheSupremeCourt!'LordeslamscontroversialRoevWaderulingonabortionduringGlastonburyperformanceasleotard-cladsingertellsfans'it'sgoodtobeback' NowPrinceCharlescharityfacesprobeover€3mincashfromQatariasCharityCommissionconsiderswhetherithasroletoplayininvestigation  PrincessBeatriceandhusbandEdoardoMapelliMozziputonacosydisplayaspropertydevelopertenderlytouchesroyal'sarmatGlastonbury TrisScottisslammedbyparentsofAstroworldvictim,9,afterflaunting$5.5millionBugattiVeyronChiron  WillPaulMcCartneystillbeonsteat90?Ibethewilltry:BeatlesbiographerHUNTERDIESonatear-jerkingperformancefromalivinglegend  'Somanywomenandsomanygirlsaregonnadie':OliviaRodrigonamecheckstheSCOTUSjusticesonGlastonburysteandthenduets'F**kYou'withLilyAllen  'Mydogtooktothesestraightaway!'TakealookattheindoorGRASSpottypadthat'shelpedthousandsofdogownerswithyoungpupsaswellasthoselivinginapartmentsortrellingPromoted 'Mostbeautifulgirlintheworld'ThylaneBlondeaushowcasesherstyleindouble-denimensembleatKenzoshowduringParisFashionWeek TopGun:Mericksoarspast$1Battheglobalboxofficeandbecomesthehighest-grossingfilmofTomCruise'scareer STEPHENGLOVER:PrinceCharleseitherdemonstratedastonishingnaivetyorthearroganceofsomeonewhodoesn'tbelieveheisconstrainedbyconventions AdvertisementMariahCareywowsinsexyLBDasshegoofsaroundwithTiffanyHaddishduringsurpriseappearanceatHollywoodUnlockedImpactAwards  CharlizeTheronlookseveryinchthedotingmotherassheenjoysafamilymealinRomewithdaughtersJackson,10,andAugust,7 JessicaBielcutsfashionablefigureinablackandwhitesuitwhileoutwithherhusbandJustinTimberlakeinParis Royallyembarrassed!PrincessBeatriceisleftblushingafterherbankcardwas'declinedTHREEtimesatMichelin-starredpop-upGlastonburyfoodstall'  KimKardashiansharessexybikiniflashbackpictureofa'lazySunday'...beforeshowcasinghertrimwaistinSkimsunderwear AdvertisementHaydenChristensenrevealshisdaughterBriarRoseplayedhissparringpartnertohelphimprepareforhisroleasDarthVaderinObi-WanKenobi AC/DCdrummerPhilRuddandJasmineBentamimovedtoAustraliaandhadababybeforetherockstar'scocaineaddictiondestroyedeverything AlexaChungputsonaleggydisplayinablackleatherzip-upminidressatGlastonbury...amidher'split'fromboyfriendOrsonFry RoseLesliecutsacasualfigurealongsidehusbandKitHaringtonastheyattendthefinaldayofGlastonburyFestival LilyJamesfuelsspeculationshe'sengedtoboyfriendMichaelSchumanasshe'sspottedwithgoldringonherfinger CristianoRonaldoputsonaloved-updisplaywithhispartnerGeorginaRodriguezastheypackonthePDAduringnightoutinIbiza OliviaMunnpushessonMalcolminhisstrollerasshegoesforleisurelymorningwalk...afterJohnMulaney'slatestsold-outshowatMadisonSquareGarden MelGibson,66,iseveryinchthefamilymanashetakeshisgirlfriendRosalindRoss,31,andtheirsonLarsoutforfrozenyogurtinMalibu KylieMinoguestrugglestocontainherexcitementwhilewatchingDianaRoss'headlinegigatGlastonbury 'Iamfilledwiththankfulnessforeachofyou!'DianaRoss,78,closesGlastonburywithbacktobackhitsasMotownlegendsaysgoodbyetothepandemic AdvertisementMadonna'sdaughterLourdesLeongoesbra-lessinsheertopassheissupportedbybrotherRoccoRitchiebacksteafterwalkingParisFashionWeekshow JenniferLawrenceandhusbandCookeMaroneycheckoutanearly$20millionmansionastheyhousehuntinBel-Air...afterwelcomingfirstchild 'Datenight!':GeriandChristianHornertreltoGlastonburyFestivalinstyleastheyarrivebychoppertowatchSirPaulMcCartneyperform  RitaOrawowsinapinkfloralbraletteandtightblackvinyltrousersatGlastonbury-amidclaimsshe'ssettowedbeauTaikaWaititi'imminently' ThisistheBESTwater-resistantsunscreenforhigh-levelfaceandbodyprotectionaccordingtoAmazonshoppers-andit'snowreducedby27%tolessthan$13foratwo-packPromoted MichaelGandolfinikeepsitverycasualinabutton-upshirtandjeanswhilestrollingthroughthestreetsofNewYorkCity JessicaBielshowcasesherwashboardabsinblackbraassheandhusbandJustinTimberlakesit frontrowatKenzoshowduringParisFashionWeek  AlecBaldwin'sdaughterIreland,26,showsoffhertattoosassheposesNUDEinbathtub...afterdeclaringherself'ashamedtobeanAmerican'inwakeofRoev.Wadereversal TarajiP.HensonshowsofftonedlegsinalimegreenminidresswhilePaulaPattoniselegantinabluegownastheyattendBETAwardsdinnerinLA CateBlanchettdonsacreamboilersuitassheandWoody HarrelsonleadthestarsatthefinaldayofGlastonburyFestival -whileLilyJameskeepsalowprofileinthecrowd AdvertisementEltonJohn'shealthtour!GuitaristDeyJohnstonesaysvitaminsandherbalteaaretheorderofbusinessforFarewellYellowBrickRoadgigs SellingSunset'sChristineQuinnsizzlesinastraplessLBDasshestrollsalongMiamiwaterfront...assherevealsshe'llbesellingluxuryresidencesintheSunshineState CruzBeckham,17,sportsagoldcannabisdesignnecklaceasheoptsforveryedgylookforKenzoshowduringParisFashionWeek BachelorNationstarCamAyalarevealsheunderwentlegamputationsurgeryfollowinglife-longbattlewithlymphedema This200millionviewTikTokfamous'PeelAndReveal'LipStainKitsealspigmentintothetoplayerofyourlipsandissopopularitsoldouteighttimesin2021-butit'snowBACKINSTOCKPromoted CardiBrespondstoonlinetrollwhocalledthree-year-olddaughterKulture'autistic'asshetellsthemto'goplayintraffic'...butgetsblowbackasfanspointoutthatautismisnotan'insult' JodieKiddembracessummerinabreezyfloralprintdressasshejoinsfiancéJosephBatesatlishCartierStyleEtLuxeevent JohnMulaneyandOliviaMunnstayclosetotheirbabysonMalcolmwhileleingtheGreenwichHotelinNewYorkCity KendallJennershowsexDevinBookerwhathe'smissingassheflashesherabsinblacksportsbraandleggingsamidworkout  CamilaCabellodemonstratesquirkystylewithfrou-froufeatherycuffs...asrumorsflysheisinvolvedwithdatingappfounderAustinKevitch AdvertisementHalleBerryandMarkWahlbergspottedfilmingdaringstuntsfornewmovieOurManFromJerseyinLondon 'Somanyemotions':LilyAllenrevealsshe's'overwhelmed'afterperformingherhitF**kYouatGlastonburywithOliviaRodrigoafteralmostthreeyearssobriety SirPaulMcCartneybecomestheoldestEVERsolostartoheadlineUK'sGlastonburyfestival-beingserenadedbythecrowdwithHappyBirthdayafterturning80 MeetthemastermindbehindSirPaulMcCartney'svirtualduetwithJohn:DirectorPeterJacksonengineereditbyusing'customAI' LooklishlikeTheDuchessofCambridgeinanLKBennettteadressorshopasimilarlookinspiredbyKateforless!Promoted ToriSpellingdonsflowingyellowdressasshetakesfourofherkidstothepremiereofMinions:TheRiseofGruinHollywood...amid'trialseparation'fromhusbandDeanMcDermott JuliaFoxbaresherwashboardabsinaburgundyleathertopandpantswhileattendingtheMADEClassof2022showinNewYorkCity SummerWalkerannouncessheispregnantwithsecondbaby:'It'sreallypeaceful,reallyhappy,lotsofhelp,lotsoflove' RonnieWood,75,iswedatbywifeSally,44,andtwins GracieJaneandAliceRose,6,asheperformswiththeRollingStonesat BritishSummerTimeFestival DeGrohlappearsonstewithSirPaulMcCartneyatUK'sGlastonburyfestivalinfirstconcertsinceTaylorHawkins'death-aheadofFooFighterstributeconcerts AdvertisementAfterthecultNetflixseriessawanewgenerationoffansbewitchedbythepopiconKateBush,JOMACFARLANErevealsit'snotjusthermusicthat'smystical GuyRitchiewaspaid$23milliondividendlastyearfollowingfilmsuccess-afterusingfurloughschemetopayworkersduringlockdown Lil'KimputsonbustydisplayinVERYsheertigerprintbodysuitassheplaysPrideIslandfestivalinNYC SherylCrowandPaulRuddareamongdozensofcelebritiestolendtheirsupportforBigSlickCelebrityWeekendfundraiserforChildren'sMercyCancerCenterinKansasCity Supermodelsummerstyleforlessthan$30:shoppersaresnappingthiscoordinatingsetmadefromthisseason'smust-hemicro-pleatplissefabricinseveralcolorsPromoted 'Weifyoudriveby!'HaileyBiebershowsoffMASSIVEbillboardforherRhodeskincarelineonSunsetBlvdinHollywood BenStillerandJohnTurturroarejoinedbyfriendsandfamilywhiletheyattendtheNantucketFilmFestivalinMassachusetts ErikaJaynekeepsitcasualinall-blackforaspadayinWestHollywood...afterclaimingsheCAN'Tpayoff$2.2Mtaxdebt LilyAnneHarrisonshowsoffhergrowingbabybumpasfiancéPeterFacinellileesacheekycomment...followingannouncementthatthey'reexpectingfirstchildtogether KimKardashianputsonbustydisplaywhilemodelingthenewSkimsKim'sSleepSetloungewear AdvertisementMary-KateOlsencutsathleticfigureinfullridingensembleduringLonginesParisEiffelJumpingcompetition SmilingPrinceAndrewbrushesasidefearshecouldbestrippedofhisDukeofYorktitleashegoeshorseridinginWindsor KristinCallariwowsinultrasexyblackbikiniasshekicksoffsummerintheHamptons  HasMissMoneypennyfinallyfoundherreal-life007?ActressNaomieHarrissnugglesupatweddingtobuddingactorDorTomicwhodescribeshimselfas'thetrueJamesBond'  OliviaRodrigoadmitsshe's'devastatedandterrified'byUSSupremeCourt'santi-abortionrulingasshesingsbringsF**kYouwithLilyAllenatGlastonbury WantsmootherANDthickerhair?TheskincarebrandAugustinusBaderlovedbyMargotRobbieandVictoriaBeckhamlaunchhaircarerangethatpromisestoincreasesmoothnessby277%Promoted 'Mybody,mymotherf****ngchoice!'MeganTheeStallionhitoutatthe'stupid-a*s'USSupremeCourt'santi-abortionrulingasshetakestothesteatUK'sGlastonburyfestival LoriHarveydisplaystrimwaistinatinycroptopandcamouflecargopantswhileoutsoloinLA...afterpromotingherskincarelineSKNbyLH JaimieAlexandersportsanall-denimlook assheshopsinWestHollywood...followingnewsthatex PeterFacinelliisexpectingachildwith fiancée LilyAnneHarrison BellaHadidcharmsinapinkprairiedresswhileWinnieHarlowshowsoffherlegsinawhiteensembleastheyattendaCreate&CultivateeventinLA AdvertisementJanetJacksonsharesthrowbackphotowithMichaelJacksonasshemournsherlatebrotherontheanniversaryofhisdeath MichaelJackson'sestateclaimsmanengedtosisterLaToyausedchaosofsinger'sdeathtostealPAJAMAShewaswearinginhoursbeforehediedaswellashisiPhone,pillsandclothes PaulWalker'sdaughterMeadowWalkerrevealsshehadanabortionin2020...asshecallstheoverturningofofRoev.Wade'heartbreaking' PeakyBlindersactressAnyaTaylor-JoysparksspeculationsheisengedtomusicianboyfriendMalcolmMcRaeassheisspottedshowingoffherring  JenniferAnistonpresentslifetimeachievementawardatDaytimeEmmystoformerlyestrangedfatherJohn Thesekidsmulti-vitamingummiesformulatedbyparentsalreadyhe65,000FIVESTARAmazonreviewsandpromisetoboosttheimmunesystemandimprovebehior-nowonsaleatlessthan$15Promoted Bonorevealshisguiltoverthewayhetreatedhislatefatherandsayshefinallyfelt'free'afterprayinginacandle-litchapelandaskingforforgiveness  MargotRobbielookslikeaBarbiebroughttolifeasshedonsahotpinkensembleontheLosAngelessetoftheupcomingmovieabouttheiconicdoll KateMiddletonposesinarmytankinnever-before-seenphotosasshewritestouchingtributetoservicemenandwomenonArmedForcesDay HeidiKlumputsonabreathtakingdisplayassheshowcaseshermodelbodyinsexyLBDduringNYCouting  AdvertisementElvisPresley'sPRguruGeneSchwamrevealshefakedLApolice'sthreattoshutdowna1957performanceasastunttosellmoretickets AshtonKutcherandMilaKunisenjoysomequalitytimetogetherastheystepoutforcoffeeandsnacksinLA BlacChynabaresskinintightone-piecebathingsuitassheanddaughterDreamenjoyadayatthebeach...asit'srevealedshewillstarinSecretSociety2 LilyAnneHarrisonannouncessheandfiancePeterFacinelliareexpectingfirstchildtogether:'I'mverypregnant' KimKardashiansharesseriesofphotosinhonoroffriendLaLaAnthony's40thbirthday:'Icouldn'tdothislifewithoutyou' Dental-qualitynightguardsforlessthan$100:Thesecustom-fittednightguardsimprovesleepandreducejawpaincausedbyteethgrinding-andDAILYMAILreaderscanse30%Promoted RebelWilsonbeamsassheposesonacliffinIcelandafterenjoyingaromantichelicopterridewithnewgirlfriendRamonaruma KarlieKlossandhusbandJoshKushnerjoinaNewYorkCitymarchprotestingtheSupremeCourt'soverturningofRoev.Wade MickJgerisbackfightingfitashegivesenergeticperformancewithTheRollingStonesinHydePark-aftermissingtourdatesduetoCovid That'sacheekyreveal!KeshaunveilshernoticeablyrounderderriereassheperformsinathonganddaringleatheroutfitatPrideinNYC AdvertisementEntourestarAdrianGrenierandJordanRoemmeleELOPEinMoroccowith'stringforrings'infrontofclosefriendsonvacation:'Itwasn'tplanned' JoseCanseco'sdaughterJosieCansecolooksstunninginnewbikinicampaignfor LuliFamaSwimwearassheposesonabeach 'Idomyrecordingfarfaraway':DameJulieAndrewsrevealssheHASN'TmettheBridgertoncast...despiteplayingLadyWhistledown SerenaWilliamslooksongreatformassheshowsoffherbackhandandsportsblackfacetapewhiletrainingaheadoftheWimbledontournament Issnoringruiningyourlife?ThesesupplementsdevelopedbyoneofAmerica'sleadingsleepexpertscanhelpyoubreathebetterwhilesleepingsoeveryonegetsmorerestPromoted TomHanks'wifeRitaWilson,65,cutsastylishfigureasshearrivesinAthensforamusicevent-aftershewasknockedoverbyafan Oscar-winningdirectorOliverStone,75,suggests#MeTooisbehindtwo-daysexualassaultallegationsaimedatPaulHgis NicoleKidmansharesrarephotofromherintimateweddingto KeithUrbaninSydneyontheir16thanniversary AlexaChungcutsastylishfigureinanelectricblueminidressandavinteBarbourjacketasshesoaksuptheatmosphereatGlastonbury JenniferGarnercutanathleticfigureinall-blackgymgearwhilerunningerrandswithsonSamuel,ten,inLA Advertisement'Shehasgotexponentiallyworsethisseason!'TheViewfansdemandWhoopiGoldbergtobeFIREDforswearingandinterrupting GretaThunberggoestoGlastonbury:Teeneclimatechangeactivist,now19,willaddressfestivalcrowdthisafternoon KhloeKardashiansharesheart-meltingsnapsoflittleTrue,four,takingannualtriptogiveicecreamtofirefighters:'Youguysareincredible' JanuaryJonesposesseductivelyinherunderwearassheupdatesfansaboutherrecoveryfromkneesurgery:'Feelin'goodandlimberain' JohnnyDepp'sdaughterLily-RoseDeppissummerystylishinflutterywhitedressoutandaboutinLA 'Beyondgrateful':Award-winningactor'honoured'tobecastasMohamedAl-FayedinnewseriesofTheCrownsettoshowDiana'sfinalyears DrewBarrymorebeamsinabrightpinkgownafterherhittalkshowtakeshomeTWOgongsduringthe 49thannualDaytimeEmmyAwardsinPasadena DreadlockedOrlandoBloomstripsdowntoarobeashetakesafilmingbreakforupcomingblockbusterWizardsonQueenslandbeach CaitlynJennerkeepsthingscasualinherracingteam'smerchasshejoinspalSophiaHutchinsattheGoodwoodFestivalofSpeedinWestSussex SirPaulMcCartneywillbecomeGlastonbury'soldestsoloheadlinertonighted80...55yearstothedaysinceTheBeatlesperformedto400million AdvertisementIsthisthereasonKateMossappearedon'90sPlatinumJubileebus?Supermodelis'outforanOBEnodforherservicestomodelling' JessicaAlvesshowsoffhercurvesinadazzlingminidressasshebrushesoffromanticwoesonnightoutinMayfairwithhandsomepal 'Howtoactthirstyandpatheticinyour60's':Madonna,63,isslammedas'desperateandclassless'byhorrifiedTwitterusersfor'tonguing'rapperTokischa,26 RitaMorenospeaksoutaboutbotchedabortionshehadduringMarlonBrandoromancebeforeRoev.Wade NetflixisprobedbyMexicanpolicefor'overworking'castandcrewofTheChosenOneaftertwoactorsdiedinvancrash DidGandy,42,oozessexappealwhileparadinghisrippedphysiqueashestripsdowntomodelhisnewPoolsideCollection WasSMOKINGtoblameforRupertMurdoch'sfourthdivorce?Mediamogul'sdislikeofJerryHall'snicotinehabitemergesasleadingtheoryfortheshocksplit TheYoungandTheRestless'MishaelMorganbecomesfirstblackwomantowinOutstandingLeadActressduringthe49thAnnualDaytimeEmmyAwards KateMosswatchesPrimalScreamfrombacksteatGlastonburyhoursafterherexPeteDohertyperformedatthefestival NewlysingleLoriHarveystrutsherstuffinbustycorsettopandmatchingpantsassheattendsBellaHadid'sKinlaunchpartyinWestHollywood AdvertisementVIDEOWATCH:TODAY'STOPVIDEOS1234WatchvideoGroomshootsfriendbymistakeatweddingperformingtraditionalgunfire...WatchvideoVideoappearstoshowindividualarrestedatsceneofOslonightclubshootingWatchvideo14-year-oldblackschoolboytackledtogroundduringsearchbypoliceinCroydonWatchvideoPassengerfilmsvideoofpeoplex27;sunattendedbgeatHeathrowHeathrow...WatchvideoJournalistSophieLongsparksoutreassheusesthephrasex27;pregnantpeoplex27;WatchvideoMomentmaleGOPRhodeIslandsenatorandcopslapsfemalerivalduringprotestWatchvideoDismemberedWWIINydestroyerisdiscoveredontheseafloor.WatchvideoBorisJohnsonandJustinTrudeaudiscusssizesofeachotherx27;saeroplanesWatchvideoManfightswithtwosecurityguardsatBristolAirport,afterpushingparterWatchvideoGrinningBorisJohnsonsharesbriefhandshakewithPrinceCharlesinRwandaWatchvideoPaulMcCartneyinvitesDeGrohionsteduringGlastonburyfestivalWatchvideoManjumpsfromwindowandcrashestotheground,asheischasedbytwowomen.DM.later('bundle',function(){DM.molFeCarousel.init('#mwv-carousel_e11fc6aa-85c3-4ba1-8929-baedc','channelCarousel',{"peCount":"4","peSize":3,"onPos":0,"nested":true,"updateStyleOnHover":true});}); adverts.addToArray({type:'728x90',pos:'leader_middle'}); GlitteringconfettiandrainbowflscolorNewYorkCityasitsannualPrideparadekicksoffThousandslinedthestreetsofNYConSundaytowerainbowfls,celebratethemovementtowardLGBTQequalityandrenewcallsforactioninfearthattheSCOTUSwillbansame-sexmarrie.ThecelebrationsonlycometwodaysaftertheSCOTUSvoted6-3tooverturnRoevWade,sparkingprotestsinmajorcitiesacrossthecountry.TheannualPrideinNYCespeciallycelebratedthenationalhistoricalsiteofthe1969riotsthatlaunchedthegayrightsmovementattheStoneWallInn,agaybar,inGreenwichVille,Manhattan.1comment6videos8sharesGlitteringconfettiandrainbowflscolorNYC'sannualPrideparade'IthinkitisthestupidestthingEVER!':NickKyrgioshitsoutatmen'sdoublesmatchesbeingbest-of-five-setsatWimbledon...andinsistsheishappytoplaythe'villain-typerole'whenhefacesBritishwildcardPaulJubbinthesinglesWhentheywoninMelbourne,KyrgiosandKokkinakisonlyhadtoplaybest-of-threesetmatchesthroughoutthetournament,butthesamecompetitionatWimbledonisplayedacrossfivesets.33comments139sharesNickKyrgioshitsoutatWimbledonrulesformen'sdoublesmatchesCatownersareexploitingtheirpetsinsocialmediaclipsinbidtobecomefamous,charitywarns Funnycatvideoshebecomesinisteraccordingtoaleadingcatcharityasownersprovoketheirpetstogarnerareactioninanattempttomaketheimesgoviral.32comments35sharesCatownersareexploitingtheirpetsonsocialmediatobecomefamousSeeinsidethisnineteenthcenturyAustralianflourmillthathasbeentransformedintoastunningfamilyhomethat'sstraightoutofafairytaleAhistoricalflourmillbuiltinthe1850shasbeentransformedintoagrandfamilyhomewith56roomsincluding billiardsroom,library,galleryspace,studio,office,boardroomandsixbedrooms.The56-roomformerCampaspeMillisinthesceniccountrysideofKyneton,justoveranhournorth-eastofMelbourneandwasmadeintoafamilyhomebyBillandHelenColebyaftertheyboughttheproperty26yearso.Withsixbedrooms,twobathrooms,andmultiplelivingareasandfunctionspacessplitacrossfourlevels,MrColebysaidrenovatingthehomewhilepreservingitscharmwasnoeasyfeat.ItfeaturesoriginalTasmanianhardwoodbeams,Balticpinefloorsandlargeoakstructuralbeamsfromasailingshipthroughout.10commentsshareInsidethegrand56-roomfamilyhomethatwasonceanoldflourmillBrandedacriminalforplayingsport,surroundedbybombsandBANNEDfromleingthecountrywithoutaman'spermission-newdocumentaryrevealstherealityoflifeforateenegirlinGazaTheGirlFromGaza,whichpremieredatItaly'sRiverFilmFestivalfollowsMariamAl-Muzainy,16,asshebattlestosecureascholarshipabroadinordertoleethecountry.10comments29sharesPalestinianteenrevealsfatherBANNEDherfromtakingscholarshipWidowofBritishjournalistDomPhillipsweepsathiscremationinBrazil-aspoliceprobe'orderedkilling'ofreporterandaideintheAmazonThewidowofmurderedBritishjournalistDomPhillipsweptafterhiscremationinBraziltodayaspolicecontinuedtheirinvestigationintothedoublemurder5comments3videos251sharesWidowofBritishjournalistDomPhillipsweepsatcremationMovingmomenttheparentsofthreechildrenmoweddownbyadrunkanddruggeddriverreceiveastandingovationattheVaticanaftertellingtheirheartbreakingstoryandwhytheyforgivemanresponsibleDannyandLeilaAbdallahwereinvitedbythePopetosharetheirharrowingstorywithhundredsofparishionersatthe2022WorldMeetingofFamiliesinRomeonSaturday.Theirthreechildren Sienna,8,Angelina,12,Antony,13,andnieceVeroniqueSakr,11,werekilledbySamuelWilliamDidsonwhowasintoxicatedandhighondrugswhilebehindthewheelonFebruary1,2020.Flankedbytheir childrenLiana,12,Alex,seven,Michael,six,and14-week-oldSelina,theAbdallahsspoketoaglobalaudienceontheeveofwouldhebeenAntony's16thbirthday.MsAbdallahrecalledtheheartbreakingmomentshelearnedherchildrenhadbeenkilledasherhusbandexplainedwhythey'vechosentoforgiventhedriver.TheirspeechwassopowerfulitbroughttheCatholicworldtotheirfeet,includingacontingentofAustraliansinthecrowdproudholdingthenationalfl.52comments1video121sharesParentsofchildrenkilledbydrunkdriverreceiveastandingovationDonx27;tmissDailyMailTVonmondayFindoutwhentheshowisoninyourareaChange  DON'TMISSKendallJennerandNBAboyfriendDevinBookersplitafterhing'whereisthisgoing'talkandrealizing'theywerenotmovingforward' SusanLuccipaystouchingtributetoherlatehusbandHelmutHuberduringDaytimeEmmysInMemoriamsegment Lizzotodonate$500KoftourproceedstoPlannedParenthoodwhichLiveNationwillmatchfortotalof$1million...after Roev.Wadehasbeenoverturned 'Thisisahorrifyingdecision':'Heartbroken'MichelleObamaleadsfuriouscriticismofSCOTUS'overturningofRoev.Wade-asAmySchumerblastsjustices ChrisNothisseenleingjewelrystorewithagiftbonedayafterpubliclycrowingoverwifeTaraandhernewplay'BrokecodeBirdswitching' Glastonburyisfinallyback!AfterTHREEYEARSofCovidcancellations,tensofthousandspartyintothenightjoinedbydozensofA-listcelebs SusanLucciisavisioninpinkwhileTamronHallandRachelLindsaydazzleinblackandgoldgownsastheyleadthestarsattendingthe49thannualDaytimeEmmyAwardsinPasadena 'Ifeelblessedtobealive':NetflixCheerstarMaddyBrum,19,revealsshewashitbyaCARgoing30MPHwhilecrossingthestreetasshesharesimefromhospital  SamiSheen,18,donsgymwearasshegoeslingerieshoppingatVictoria'sSecret...daysafterFINALLYgettingsupportfromfamousfatherCharlieoverherOnlyFanscontent KyleRichardssizzlesinlittleblackdressafterhersecretboobreductionwasrevealedasshesupportsrealestatemogulhusbandMauricioUmanskyfollowingNetflixdeal  'Ican'tbeartothinkaboutit':BillieEilish,20,admitsit'sa'darkdayforwomen'aftertheUSSupremeCourt'santi-abortionruling-asshebecomestheyoungeststarinhistorytoheadlineGlastonbury PregnantHeidiMontenjoysthegreatoutdoorswithsonGunner,four,duringColoradogetawaywithouthusbandSpencerPratt  PriscillaPresleyreflectsonsomeofhermosticoniclooksandrevealsElvisloveddressingupanddidn'tlikethelookof'beingtoorelaxed' AmberHeardisofficiallyorderedtopayJohnnyDepp$10Mfordaminghisreputationbuttheirlawyersfailtoreesettlementpingwayforcostlyappealsprocess  AshleeSimpsoncutsacasualfigureinablacktopandrippedjeansasshestepsoutwithafriendtoprivatemembers'club TheTwentyTwo JohnMulaneyandOliviaMunnwalkhand-in-handinNewYorkCityaheadofthecomedian'sstandupshowatMadisonSquareGarden IrinaShayknailscasualchicdresseddowninaSupremehoodieandblackleggingswhileoutinNYC GigiHadidflasheshertonedabsinacroppedtopandsleevelessvestasshegoesforastrollinNYC BellaHadidturnsheadsinabustier-stylepinkdressassheheadstoLORistoranteinWestHollywood NickCannonandAlyssaScotthonorlatesonZenastheyhostalightingceremonyandannouncethelaunchofapediatriccancerfoundation BruceWillisandhisdevotedwifeEmmaHemingenjoysummerstrollaftershepraisedhimforbeing'loving'and'generous'amidhealthstruggle  DailyMailTVEXCLUSIVE:DuckDynastybrothersJaseandJepRobertsonunearthlonglostrichesonFoxNation'sDuckFamilyTreasure 'Suchafunday':ChristinaHallsharesphotosfromafamilyexcursionwithherhusbandJoshHallandherkidsatanalpacafarminTennessee JapanesePrincessMakoKomurodonsafacemaskasshestrollshand-in-handwithcommonerhusbandthroughNewYorkCityafterhefailedbarexamforasecondtime KristinCallarisolicitsdatingadvicefromhersonswhotellhertogooutwithsomeone'alotolder'andto'wearbetterlipstick' 'Ajuicy,wetlook':KylieJennerprovesshehaslostthose60lbsfromhersecondpregnancyassheposesinapinkdresstopromoteherlipgloss Don'tBeCruel!BazLuhrmann'sElvisisSLAMMEDasa'shamelesscomic-bookbiopic'witha'campy'turnfromTomHanksinVERYmixedreviews MeghanTrainorconfessestohingan 'Adelemoment'onnewsongBadForMeaftertherapysessionsinspiredhertowritebrutallyhonestlyrics  'Bigdayforus!':OliviaMunnandJohnMulaney'ssonsatuponhisownforthefirsttimeinadorablenewsnap TheREALdevilindisguise?AsElvisPresley'stangledrelationshipwithColonelTomParkerisbroughttolifeonscreen,insidetheshadypastofthemaner KimKardashiantakesfansinsideherstar-studdedSKKNlaunchdinnerwithNorth,nine,andsisterKendallJennerKendallJennerstepsoutlookingsolemninspandexassheheadsforaworkoutfollowingsplitfromNBAstarDevinBookeraftertwoyearsofdating PLATELLL'SPEOPLE:ProudJerryHallshouldnottakeapennyofRupertMurdoch'sfortune MarilynMonroebecomesamodern-daysupermodel:LateHollywoodsirenisreiminedasamazinecoverstarindigital highfashionshoot Backtobasics!IvanaTrump,73,sportshersignatureblondupdoafterbeingescortedtoahairsaloninNewYorkCity BritneySpears'momLynneinsists'Ijustwanthertobehappy'despiteNOTbeinginvitedtowedding Holysmokes!Chain-smokingBradPittisseenpuffingawaywhilevolunteeringinLA-monthsbeforekickingthehabitandembracingabstinentlifestyle LarsaPippenandexScottiePippencelebratesonScottyPippenJr,21,joiningtheLALakersbasketballteam:'Couldn'tbemoreproudofyou'BenAffleckstepsoutinbluebutton-downshirtandwigtofilmscenesforuntitledNikemoviewithJasonBatemanandChrisTuckeron-set GlamorousCharlesandCamilladazzleatblacktiedinnerinRwandaastheroyalcouplegreetBorisandCarrieatCommonwealthleadersevent WinonaRyderinlove!StrangerThingsactress,50,'feelsbeauof10yearsScottMackinlayHahn,51,isasoulmate'...afterdatingJohnnyDeppandMattDamon SellingSunset'sMayaVanderopensupaboutherexitfromtheshowfollowingherheartbreakingmiscarrieandthelaunchofherrealestategroupinMiami SirEltonJohn,75,putsonanimateddisplayinflamboyantbejewelledjacketashetakestothesteintheUK EzraMilleris'livingwith25-year-oldmotherandherthreeyoungchildrenatVermontfarmhousesurroundedbymarijuanaandgunswhereonechildputaBULLETintheirmouth' LilyJamesshowsoffhertonedmidriffinaskimpydenimcroptopandjeansassheletsherhairdownatGlastonbury TheveryrockyroadthatledSharonStonetosinglemotherhood:Howactress,64,overcametwodivorces,twofailedengements,andNINEmiscarriestoadoptthreesons HeidiKlumbaressomeskininaskimpyleathervestthatleeslittletotheiminationassheposesinabathroommirrorWillChristineQuinnreturntoSellingSunset?RealityTV'villain'looksangelicinallwhiteduringaphotoshootinBeverlyHillsasherfutureonshowhangsinthebalance  PioneerWomanReeDrummond,53,willbeco-starringwithherlook-alikesisterBetsy,47,onashowaboutrenovatingaguesthouseinOklahoma AprilLoveGearymodelsastringbikinionabeachinMalibu...daysafterfiancéRobinThickegetshernakedbodytattooedonhisarm TomCruiseexhibitshismusculararmsagreypoloshirtashishelicopterarrivesinLondon-afterpromotingTopGun:MerickinSouthKorea Ex-SpandauBalletsingerweepsasheappearsincourtaccusedofsexattacks:RossWilliamWild,34,'rapedonewomanandfilmedhimselfmolestingsixothers' PinkshowsoffhercasualsideasshewearsanoversizedyellowshirtwithdarksslacksbutaddsaGuccipurseforsomeglamassheisseeninNYC RHONJ'sMelissaGorgacelebratessonGino's8thgradegraduation:'You'regoingtodoamazingthings!' That'snotBritney,b****!MadonnakissesrapperTokischaandsimulatessexactasshekicksoffNYCPride-afterTHAT2003VMAssmooch  DeChappellebuys19acresoflandinOhiotostop$39Mhousingdevelopmentafterthreateningtoditchtheareaifbuildingwentahead  TarekElMoussaandwifeHeatherRaeYoungpackonthePDAduringluxuriousyachtholidayinGreece...beforegettingbacktoworkontheirnewrealityseries ParisJacksonlooksedgyinanofftheshouldershirtandleggingswhileleingherhotelinNYCfollowingthepromotionofherlatestsingle PaulMcCartneylooksingreatspiritsashearrivesat$30-per-ticketintimategiginSomersettownaheadofheadliningGlastonburyonSaturday He'sgothisfather's(kooky)flareforfashion!CruzBeckham,17,sportscannabisnecklaceandlimegreenblazerashejoinshisdadDid,47,atDiorshowinParis Theshowmustgoon!ChrishellStause'spartnerGFlipkeepsperformingafterbreakinglefthand PaulSimon,80,tucksintoanicecreamashesoaksupthesunwithwifeEdieBrickell,56,duringfamilyholidaytoPortofino  CaraDelevingneshowsoffher eclecticsenseofstyleassheboardshelicopterflighttoGlastonburywith newloveinterestMinkeandtheirpals BlingyFeldstein!BooksmartactressBeanieshowsoffHUGEdiamondengementringoutsideFunnyGirlonBroadway....asshe'ssettomarryBonnieChanceRoberts JordynWoodsmakesastylestatementinaknitT-shirtandbrandedmidiskirtassheandbeauKarl-AnthonyTownsattendtheDiorHommeshowatPFWChrisPrattshakeshandswithWWIIveteransasheexpresseshisgratitudefortheirserviceatTerminalListpremiere:'Honorthemfortheirgreatsacrifice' JessicaBielandJustinTimberlakelooktypicallychicinbeigeensembleswhileDidBeckhamputshisbestfashionfootforwardin silksuitastheyattend ParisFashionWeek TheHillsstarLaurenConradadmitssheconsideredareturntorealityTVtopromoteherbrandbutdecidedainstit:'Ifeellikeit'sjustaprivilegetohemyprivacy' LilyJamesflasheshermidriffinablackbratopandjeanswhilePoppyDelevingne,TigerlilyTaylorandSiennaMillershowcasetheirsensationalstyleatGlastonbury 'It'stheabsolutedream':MelChintsthattheSpiceGirlswilldoGlastonburynextyearandhasa'goodfeeling'VictoriaBeckhamwillreuniteasoddsarecutbybookies JenniferMeyercallssplitwithTobeyMuire'beautiful'andsaysshewoulddo'anythingintheworldforhim'Jennifermadeararecommentaboutthesplit 'Iwashingthoughtsofendingmylife':ZacharyLevirevealshehadacompletementalbreakdownandwasadmittedtoa'psychward' BrooklynBeckhamcuddlesPVC-cladwifeNicolaPeltzinstunningbehind-the-scenessnapsfromTatlershootinwhichsheaddressedhis'pressuretopleasepeoplewithhiscareer' SharonStonesharesthatshehas'lostninechildren'throughmiscarries-severalatlaterstesofpregnancy-beforeadoptinghersons  Kate'snottheonlyroyalportraitfail!AspaintingoftheDuchessispanned,FEMAILrevealsit'sjustthelatestofthemonarchy'smanycatastrophes  NaomiCampbellcutsastylishfigureinachicsuitandoversizedshadesattheDiorshowduringParisFashionWeek 'Idon'theanxietyaboutit':SarahJessicaParker,57,saysshe'doesn'tthinkabouteing'andbelievesshamingwomenforgettingolderis'sexist' HeatherGraham,52,flauntsincrediblefigureinastringbikiniassheenjoysgetawaytoTurksandCaicosIslands Readyforsummer!TaleOfTailsactressBlancaBlancomodelsablueBabyDolldressasshehitsawhiskyeventinLosAngeles Rockingroyals!PrincessBeatricedonsakhakiminidressasshearrivesatGlastonburywithhusbandEdo-freshfromaglitzypartyattheNationalGallery MeettheHemsworths!ChrisisjoinedatThor:LoveandThunderpremierebybrotherLuke,sister-in-lawSamanthaandparentsLeonieandCraig LedZeppelinguitaristJimmyPeisgivenpermissiontoprunebaytreeingardenofhis$3.7mmansion  KimKardashianhad'vinaarea'ofSKIMSbodysuitwidened'justfor'Khloewhosaidthe'sliver'wastoonarrowformembersofthe'bigp****club' TheRollingStones'backstesecrets:Dressingroomslitteredwithskeletons,Jger'swarmuproutineandlastminutechanges  OliviaMunnandJohnMulaneyholdhandsastheywalktoMadisonSquareGardeninNYonrareoutingaheadofcomedian'sstand-upshow SpiceGirlssingerEmmaBuntonsaysthegirlgroupplanstotourDownUnder:'IwanttocometoAustralianow.I'mready' BillieEilish'smotherrevealsthe'pressure'placedonthesinger,20,workingwithherrelativesandclimateanxietyaheadofGlastonbury  DirectorBazLuhrmannrevealswhatPriscillaPresleyREALLYthoughtofhisblockbusterElvisbiopic:'Shewasveryemotional' AmySchumeradmitssheFIREDPennBadgley's'goddess'wifeDominoKirkeasherdoulaaftergivingbirthbecauseitmadeherfeel'sovulnerable' AngelinaJolietakeschargewhiledirectingWithoutBloodinRome-whilestarSalmaHayektakestimeoutfromfilmingthetensescenestosmoke JamesBondproducerBarbaraBroccoliishonoredwithaCBEatBuckinghamPalacealongsideherbrotherMichaelG.Wilson JohnnyDepp'slawyerCamilleVasquezflashesasmileaheadofmeeting-thedaybeforesitdownwithAmberHeard'steam NataliePortmanandTessaThompsonhittheredcarpetindazzlingdressesastheyjoinChrisHemsworthatLApremiereofThor:LoveAndThunder Queenis'backinthesaddleandridingherhorseain'afterditchingwalkingstickdespitemobilityproblems  JuliaFoxsizzlesinracyblackleatherensembleasshemakesherwaytoDowntownNYCbarbeforeheadingtosurpriseperformancebyMadonna JohnnyDepp'sattorneyCamilleVasquezishailedas'wonderwoman'afterrushingtohelppassengerwhocollapsed  SirPaulMcCartney, 80,willplayasecretGlastonburysetonFridaybeforeheadliningthePyramidSte-with£25ticketssellingoutinunderanhour ChristianBaleandwifeSibiBlaziccolor-coordinateinblackforpremiereofThor:LoveAndThunderinLA...asactormakeshisdebutasnewestMarvelvillain  'Did'salwaysgotmyback!':Not-so-PoshVictoriaBeckhamoffersfansdoggylitterbtipsafterherhusbandcomestotherescueonawalkwithspanielFig DoctorWhostarKarenGillanisfabinnudefloraldressasshejoinsstar-studdedHollywoodredcarpetforThor:LoveAndThunder GoodLuckToYouLeoGrande'sDarylMcCormackandEmmaThompsonoptednottouseanintimacycoachbecausetheywantedtodotheirownthing  'Ilovethisgirl!'LilyRoseDepplooksstunninginsnapssharedbyTroyeSivanasthepairfilmnewshowTheIdol ChrisPrattreactstocontroversyoverhimbeingcastasMarioinSuperMarioBros.filmashe'snotofItalianherite HelenMirren,76,looksradiantintheWhiteBird:AWonderStorytrailerassheissettostarinthefilmthataimstosparkamovementto'choosekind' Fromsupercarsandprivatejetsto...aNissan!MultimillionaireTaylorSwift buysbudgetfamilycartogetaroundLondon'incognito'  SellingSunset'sChrishellStauseleeslittletotheiminationinablackmeshdressasshejoinsco-starsatNetflix'sOpenHousecocktailparty  KimKardashianlookalikeChaneyJonesshowsoffherhourglasscurvesinathongbikiniassheandmodelCheyAndersonfrolicinMalibu KimKardashianenjoysarollercoasterridewithsonSaint,six,afterSCOLDINGhimduringTonightShowappearance BonoenjoysHarryStylesgiginDublinashesingsalongtoOneDirectionsongswithwifeAliHewsonandchildreninrarelyseenfamilysnaps  BritneySpearsperfectlyfitsintojeansshehasn'twornin20years...asshecontinuesmovingintohernewhomewithhusbandSamAsghari DeniseRichards,51,launchesherOWNOnlyFanspe-daysafterex-husbandCharlieSheenslammedherforlettingdaughterSami,18,join  BeamingMayaHenryenjoysanothergirls'nightoutinLondonafterhersplitfromLiamPayneasshewowsinasizzlingcut-outblackdress   TaylorSwiftcelebratesreleaseofnewsongCarolinabysharingdetailsaboutthewritingprocessandtheballad'smeaning MelrosePlacestarsDaphneZuniga,LauraLeightonandCourtneyThorne-Smithlookoverjoyedastheyheamini-reunionatlunch 'Muchoamor':GeorginaRodriguezlooksincredibleinablackbikinitopassheenjoysafamilygetawaytoMallorcawithCristianoRonaldo ElizabethHurley,57,putsonabustydisplayinaplungingredgownassheattendsglitteringchocolatebashinBerlin CynthiaBaileyandKandiBurrussofRealHousewivesOfAtlantafamebringtheirhusbandstoHouseOfBETeventinLA TrisScottpoststhrowbacksnapofhimselfwithNUDEKylieJennerfromthemakeupmogul'ssizzlingPlayboyshoot JamieAlexanderstunsinant-gardelookincludingpurplewrapdressforLosAngelespremiereofThor:LoveAndThunder JessieJamesDeckerrevealsshe'sdepressedandstrugglingwithbodyimeissuesincandidpost:'Myanxietyhasgottenworse' YoungandtheRestlessstarMelissaOrdwayrevealsshehastestedpositiveforCOVID-19andwillhetomissthe2022DaytimeEmmyAwards TommyDorfmanshimmersinametallicbluedressataPridescreeningoftheslashercomedyBodiesBodiesBodiesinNewYorkCity TessaThompsonglowsinalustrousblackdresswhilehighlightinghertauttummyattheThor:LoveAndThunderpremiereinLosAngeles NataliePortmanputshertonedlegsondisplayinshimmerybeadeddressatthepremiereofThor:LoveandThunderinLosAngeles EmilyRatajkowskiflashesunderboobandbarestautmidriffinskimpymeshpeekaboodressoutinNYC ChrisPrattrocksastylishsuitwhilehittingtheredcarpetfortheLosAngelespremiereofThor:LoveandThunder NickyMinaj'shusbandKennethPettycouldbeJAILEDforayearasfederalprosecutorslooktosentencehimfor'failingtoregisterasasexoffender' KatDenningsgetscozywithmusicianbeauAndrewW.K.oncarpetofThor:LoveAndThunderpremiere ChelseaHandlersueslingeriecompanyThirdLovefor$1.5Mclaimingtheybackedoutofendorsementcontract JenniferLopezwearsasexybacklessdresswhilestoppingbyfiancéBenAffleck'smoviesetwithmanerBennyMedina Kate'skickabout!DuchessshowsoffherfootballskillsandsipsonabeerassheattendsCambridgeshireCountyDaywithPrinceWilliam BellaHadidstopstoadmireherthree-storyhighphototakenfromthenewBalenciacampaignthat'sonthesideofNYCbuilding IrinaShaykbringsCaliforniacasualtoNewYorkCityasshestepsoutwithdaughterLeaDeSeine,five,sheshareswithexBradleyCooper DerekHoughandfiancéeHayleyErbertpackonthePDAastheycoupleuponshoppingexcursioninLA...withtheirweddingplanninginfullflow MayaVanderconfirmsshe'sdoneforgoodwithSellingSunsetasshefocusesonherMiamirealestatefirm...aftersheannouncedhermiscarrie JerseyShore:FamilyVacation:AngelinaPivarnickgoestoMexicotoseehernewguyashusbandmovesout KellyClarkson'sex-husbandBrandonBlackstockpurchases$1.8millionMontanahome...afterleingranchheoncelivedinwithstar ScheanaShayandfiancéBrockDiesgrabcoffeeandgoforastrollwithone-year-olddaughterSummerMooninSanDiego ElsaPatakymarvelsinplungingwhitedressasshegoesbralessforLApremiereofThor:LoveandThunderwithhusbandChrisHemsworth  PinkFloydintalkstosellitsmusiccatalogfor$500Mwhichwouldmakeitamongtherichestmusicsalesinhistory JuliaFoxbarelycoversherampleassetsinanArtemisi3D-printedtopandbluejeansinNYC SouthernCharmstarCraigConoversayslong-distancerelationshipwithPaigeDeSorbois'gettingharderandharder' ToddandJulieChrisleyrequestprayersfromfansafterfraudandtaxevasionconviction:'Thebestgiftyoucouldgiveus' ErikaJaynestepsoutincasualblack-and-whiteoutfitwhilerunningerrandsinWestHollywood Madonna,63,putsonVERYbustydisplayinkinkyblackleatherbodiceinnewvideoreminiscentofherraunchy1990hitJustifyMyLove KhloeKardashianshowsofftrimframetakingpartinHotOneschallengeasshespillsonrealityTVeditingfailsafterfanscalloutTheKardashians LoriHarveypostssexynewcontentshowingoffcleeatthegym...aftererasingexMichaelB.Jordanfromhersocialmediaaccounts KyleRichards'husbandMauricioUmanskyanddaughterswillstarinnewNetflixrealestaterealityshowBuyingBeverlyHills Entourestar AdrianGrenierandlongtimeloveJordanRoemmeleelopewhilevacationingwithfriendsinMorocco: JaneTheVirginstarGinaRodriguezandThoractorZacharyLevijoinSpyKidsmovierebootonNetflix Euphoria'sSydneySweeneygoesgaforGucciandchatsjoiningtheMCU:'I'mabouttostartshootingMadameWebwithDakotaJohnson!' 'Mydaughtergemethat!'AlPacinorevealshe'sNOTaShrekfanafterallasheexplainshehadnoideagreenogrewasonhisphonecasethatwentviral TheJenniferHudsonShow:FirstlookattheEGOTwinner'stalkshow...whichfeaturesstarsingingtotheaudience:'I'velivedalotoflife' PrincessBeatriceandhusbandEdoardoMapelliMozzilookdapperinmatchingblackandwhiteoutfitsatNationalGallery'sSummerparty WillowSmithputsonaleggyshowongroceryruninCalabasaswhilebrotherJadenvisitssamestorelaterwithgirlfriend SabZada EmiliaClarkeconfirmsGameofThronesco-starKitHarington'snewsequelseries...revealingtheJonSnowactoriscreatingtheshowaswell BarbariantrailerfindsGeorginaCampbellandBillSkarsgarddouble-bookedatanAirBnBastheirlivesareturnedupsidedown Raiseyourglass!PinkgetsthepartystartedasshestepsoutclutchingthreebottlesofwineinNYC Inside'CampNorth'!KourtneyKardashiansharesfootefromniece'sninthbirthdaycelebrationinthewilderness TeddiMellencampArroyeclaimsthatVickiGunvalsontriedtotakeherjobasaniHeartRadiopodcasthostalongsideTamraJudge GwynethPaltrowbuys$60woodenmasserollersinabidtoremoveaccessfatandbanishcellulite EmilyRatajkowskiputsonabustydisplayinacolorfultanktopandshrugasshestrollsinNewYorkCityafterdroppingbyadeli LenaDunhamplaysapregnantwifewhosehusbandisentangledinasexualaffairwitha'naive'youngerwomaninthered-bandtrailerforSharpStick RHOCstarNoellaBergenerrevealsshehassplitfromherbusinessmanboyfriendandisbackon'sugarbaby'siteSeeking-whereshemetex-husbandJamesNaomiCampbellnailssummerchicinalemonco-ordasCara Delevingnestormstherunwayinaleatherjacketatthe AlexandreMattiussiPFWshow ALISONBOSHOFF:GuyRitchiemovieOperationFortunestarringHughGrantandJasonStathamdelayed'toeditoutnationalityofUkrainiangangsters' AlyssaScottmarksherandNickCannon'slatesonZen's'heenly'firstbirthdayaftertricdeath:'Iwillbetheonetoblowouthisfirstcandle' TheSimpsonsstarYeardleySmith,57,detailsdecades-longbulimiabattle-revealinghowdesperatedesiretobe'perfect'triggered24-yeareatingdisorder 'Catwoman'JocelynWildenstein,82,andfiancéLloydKlein,55,appearloved-upinHEILY-filteredsnapsfollowing18-yearrockyromance- SisterWives'KodyandestrangedwifeChristineBrownsettobecomegrandparentsainasdaughterMykeltirevealsshe'spregnantwithtwins Halseyindulgesinice-creamconeinCalabasasafterlamentingbeingallergicto'everything'includingmilkandcoconuts  BlackInkCrewfiresCeaserEmanuelafteranimalabuseclipashislawyersays'thereisnopoliceinvolvement'insituation 'Hefeltalotofpressuretopleasepeoplewithhiscareer':NicolaPeltzsaysherhusbandBrooklynBeckhamis'inheen'workingasachef Ex-membersofRickyMartin'sformerboybandMenudosaytheirmanersubjectedthemtoabuseclaimingtheywereexposedtodrugsand'predators'who'RAPED'them 'Whatabouttheresidency?':AdelerevealslineupforherupcomingHydeParkshowbutdisappointedfansreaboutdelayedLasVegasgigs Norththeinfluencer!KimKardashianrecruitsherdaughter,9,totestoutherskincarerangeforInstramvideoAnythingKyliecando!Jenner'sexBFFJordynWoodslandsPlayboymazinecover...threeyearsafterbeingcancelledbytheKardashiansforTristanThompsonscandal SellingSunsetrenewedforTWOmoreseasonsonNetflix...butshowvillainChristineQuinnremainsSILENTamidrumorsofcastshakeup BeanieFeldsteinisENGED!BooksmartactresssettomarrygirlfriendBonnieChanceRoberts HughGrantdonsahilariousTonytheTigersuitashejoinsJerrySeinfeldonthesetofhisupcomingPop-TartsfilmUnfrostedinLosAngeles PregnantDWTSproSharnaBurgessshowsoffherbabybumpinanudematernityphotoshootwith boyfriendBrianAustinGreen TomHiddlestonrevealsfilmingLokiinapandemicbubblewasthemost'profound'momentofhiscareer BritneySpearsandIranian-bornhusbandSamAsgharifeatureoncoverofTehranWeeklyaftertyingtheknot Barbiehasabadday!MargotRobbielooksforlornonsetasshecontinuesfilmingalongsideRyanGoslingasKen  RayLiotta'sfiancéeJacyNittolosharesher'deeppain'atlosingGoodfellasstaronemonthafterhissuddendeath:'Imisshimeverysecondofeveryday' KimKardashianstunsinsheergraySkimsdressinthrowbackvideo...afterwrappingupherwhirlwindpresstourforherskincarebrandSKKN  adverts.addToArray({type:'728x90',pos:'leader_lower_middle'}); homeWatchEditor'sTopPicks...123456789101112WatchvideoMTGtellsBritishjournalist'gobacktoyourcountry'aftershewasquestionedonSecondAmdandchildren'ssafetyWatchvideoKrankallandparentsspeakpostburnWatchvideoWestminster:FirstbloodhoundwinnereverWatchvideoPassengeristhrownoffAirCanadaflightWatchvideoFloridapoliceshowupatpartyin$8Mhome...WatchvideoNYCapprovesbiggestrenthikesinadecadeWatchvideoPlaneslidesoffrunwayandcatchesfireWatchvideoCosbyvictimspeaksafterguiltyverdictWatchvideoDelonteWestspottedpanhandlinginVAWatchvideoMuskis'undecided'aboutifhewould...WatchvideoTrelchaoshundredsofflightscanceledWatchvideoCitizenslifttaxioffpeopletrappedunderWatchvideoUvaldefamiliescallforpolicechieffiredWatchvideoIranianspeedboatturnstoUSwarshippathWatchvideoHeardshopsinTJMaxxafterbeingordered...WatchvideoMomentBidenfallsoffhisbikeWatchvideoHorsespookedpullingPrincessBeatriceWatchvideoCopshootsmanchargingathimwithanaxWatchvideoKimandPetearelovedupinTahitiWatchvideo'Backthef**koff':TomHanksrushesto...WatchvideoDestroyedcabinrushingdownMontanariverWatchvideoKhloeKardashianreactstocheatingscandalWatchvideoDumpsterdog'sincrediblerecoveryWatchvideoMeninswimmingtrunksfistfightatfamily...WatchvideoGroomfromhellpuncheshiswifeonsteWatchvideoNewgentsaystransitionsurgery'iswrong'WatchvideoHouseslipsintofloodedYellowstoneriverWatchvideoFranDrescherwill'nevermarryain'WatchvideoPrinceCharlesandCamillaleadcarrieWatchvideoMarsJunctionplays'Don'tStopBelievin'WatchvideoBTSsuperstarsgoon'temporaryhiatus'WatchvideoMamabearopensacarwhilescengingWatchvideoGiantmonitorlizardsfightfordominanceWatchvideoHilariousmomentwomanisleftterrifiedas...WatchvideoPeoplesubwaysurfcarsacrossNYCbridgeWatchvideoManrushessteatMarchForOurLivesWatchvideoCopsarrestallegedneo-NazigroupinIdahoWatchvideoDriversshutdownahighwaytododonutsWatchvideoBritneySpears'firsthusbandlivestreams...WatchvideoCheneysaysPerrysoughtpardonWatchvideoMeganFoxandfianceMGKatTauruspremiereWatchvideoRebelWilsonglamsupwithnowrevealed...WatchvideoDonatellachatsdesigningBritney'sdressWatchvideoHalsey'sconcertisfloodedfansdrenchedWatchvideoProtestertackledbyBidenmotorcadeWatchvideoUSHousepassesnewguncontrolbillafter...WatchvideoUvaldedoctorpleadsforguncontrolWatchvideoBidenwelcomespresidentstoSummitWatchvideoToplessprotestersrunontoNBAcourtWatchvideoMcConaugheygivesspeechonUvaldevictimsWatchvideoPre-schoolteacherscaughtabusingkidsWatchvideoGunmanstealsdeliverydriver'sgoldchainWatchvideoYoungwoman'stalkingparrothelpsherdeal...WatchvideoPolicebreakdownman'sdoorWatchvideoPoliceattackedbydrunkencrowdsWatchvideoPeteDidsonseenholdinghandswithSaintWatchvideoQueenstarsinsketchwithPaddingtonBearWatchvideo16-year-olddrivermowsdownamomandbabyWatchvideoMomentcrowdfleesafterPhillyshootingWatchvideoDisneylandworkerruinsromanticproposalWatchvideoArizonaofficersstandbyasmandrownsWatchvideoGrandfatherofUvaldevictimconfrontscopsWatchvideoNYCgirlstabbedbystrangerWatchvideoJohnnyDeppreactstotrialverdictWatchvideoPregnantblackwomanshotwhilehandcuffedWatchvideoPrincessCharlotteadorablytellsPrince...WatchvideoMumdocumentsgivingbirthintheoceanWatchvideoTheQueenandroyalsappearonthebalconyWatchvideoDeppturnsupinNewcastleafterbigwinWatchvideoHunterBidenripsfartswhilesittingnakedWatchvideoJohnnyDeppwinsdefamationcaseainst...WatchvideoMostmemorablemomentsofDepp-HeardtrialWatchvideoBidenmeetswithbabyformulamanufacturersWatchvideoGreatwhitesharkfeastingonsealWatchvideoUSsends$700mworthofweaponstoUkraineWatchvideoMexicohitbyfloodingfromHurricaneWatchvideoShopliftersransackSephorastoreinLAWatchvideoNYersfillstreetsforManhattanhengeWatchvideoMTGcallsPetridish'peachtreedish'WatchvideoUSNalAcademy'sclassof2022tosstheir...WatchvideoNewYorkwomanisattackedonsubwayWatchvideoEllentearsupduringfinalepisodeofshowWatchvideoTexaspolicerestraindesperateparentsWatchvideoKateMosstestifiesDeppneverpushedherWatchvideoMandressesinrealisticdogcostumeWatchvideoVasquezgrillsHeardincross-examinationWatchvideoQuarterbackDeshaunWatsondeniessexual...WatchvideoCali.KarenhurlsracialabuseatBlackmanWatchvideoFightbreaksoutbetweenUnitedAirlines...WatchvideoIndianawomanaccusesmarriedpastorof...WatchvideoRickyGervais'jokeangerstranscommunityWatchvideoAdamstalksnewsubwaysecuritymeasuresWatchvideoKendallstumblesupstairsafterweddingDM.later('bundle',function(){DM.molFeCarousel.init('#p-1532','channelCarousel',{"peCount":"12","peSize":2,"onPos":0,"nested":true,"updateStyleOnHover":true});});NorwegianroyalsremembervictimsofOsloterrorattackongaybar:CrownPrincessMette-Maritjoinsofficialsatmemorialaftergunmankilledtwoandinjuredmorethan20beforecity'sPrideparadeMembersoftheNorwegianroyalfamilyandtheprimeministerattendedamemorialserviceforthosekilledandinjuredintheOslogaybarshootingonFridaynight.ZaniarMatapour,42,hasbeenchargedwithterroroffencesafteropeningfireatthecitycentreLGBT+hauntLondonPubintheearlyhoursonSaturdaymorning.Morethan20peoplewereinjured,withtenseriouslywoundedinthegunfire.Matapourwasarrestedatthescenewiththehelpofclubgoersataround1.15am.Shortlybeforemiddaylocaltime,leadingpoliticiansincludingPrimeMinister JonasGahrStøreattendedaserviceatOsloCathedral.2comments4videos545sharesNorwegianroyalsremembervictimsofOsloterrorattackongaybarJanetJacksonsharesthrowbackphotowithMichaelJacksonasshemournsherlatebrotherontheanniversaryofhisdeathJanetJacksonpaidtributetoherlatebrotherMichaelJacksonontheanniversaryofhisdeath14yearso.1comment630sharesJanetJacksonsharesthrowbackphotowithMichaelondeathanniversary'Touringgetsdifficultonyourbody':EltonJohn'sguitaristDeyJohnstone,71, saysvitaminsandherbalteaaretheorderofbusinessforsinger,75,asheperformsFarewellYellowBrickRoadgigsThesinger,75,iscurrentlyonhisFarewellYellowBrickRoadtour andhisguitaristDeyJohnstonetoldhowtrellingforgigsis'difficultbusiness'whenyou'reolder.12comments1video141sharesEltonJohn'stourispoweredbyvitaminsandherbalteaFromRafaelNadal'sAstonMartinDBStoNovakDjokovic'sBentleyGTContinental...Wimbledonstarshesomeofthebiggestandbestcarcollectionsworthover$1MthankstotheirstgeringprizemoneyWimbledonisfastapproachingandtheworld'sbestathleteswillbebattlingitouttogettheirhandsoftheGrandSlamtrophyandthelucrativepaychequethatcomeswithit.Asaresult,Sportsmailtakenalookateachstars'carcollections-identifyingwho whoistoppingthechartsfor biggestandbest assortment.(Pictured:StarsandtheircarsincludingRafaelNadal(left),NovakDjokovic(topleftinset),SerenaWilliams(toprightinset)andNaomiOsaka(right).1comment49sharesTheseWimbledonstarshesomeofbiggestandbestassortmentofcars  ShowbizextraMarriedAtFirstSight'sOliviaFrazerbecomesoneofthepopularcreatorsonOnlyFansovernightassheboastsofearning$10,000inhours VanessaWhiteshowsoffherphysiqueinagreenandblueone-shoulderjumpsuitassheattendsBurberryeventwithherbeau EmmanuelLawal NewlywedPixieLottshowsoffherenviableframeinaskimpylilacbikiniassherelaxesonherhoneymooninTuscanywithhusbandOliverCheshire IrisLawandMiaReganseeminhighspiritsastheydresstoimpressineyecatchingfestivalattireatGlastonbury XFactorstarLouisaJohnsonshowsoffhertonedphysiqueinaskimpycreamthongbikiniasshesoaksupthesunwithpalsinIbiza Herecomesthebride!BachelorstarLauraByrnechoosesaweddingdressasshegetsreadytotietheknotwithMattyJ:'Ican'twaittomarrytheshiznayoutofyou' MarriedAtFirstSight'snextseasonwillbetheraciesteverwithsexexpertAlessandraRampollasettocreate'passionbetweenthenewlyweds' BustyEmilyAtackwowsinaplungingredsilkdressassheposesupastormonatafriendswedding HarryMuireandFernHawkins'wedding:LastminutepreparationsareunderwayasdozensofflowersarriveafterthefootballerwasspottedatFrenchchâteau JackGrealishreuniteswithgirlfriendSashaAttwoodinMykonosforex-AstonVillapal'swedding...afterleingIbizaclubwithmysterybrunette'at3:30am' VIDEOWATCH:TODAY'STOPVIDEOS1234WatchvideoGroomshootsfriendbymistakeatweddingperformingtraditionalgunfire...WatchvideoVideoappearstoshowindividualarrestedatsceneofOslonightclubshootingWatchvideo14-year-oldblackschoolboytackledtogroundduringsearchbypoliceinCroydonWatchvideoPassengerfilmsvideoofpeoplex27;sunattendedbgeatHeathrowHeathrow...WatchvideoJournalistSophieLongsparksoutreassheusesthephrasex27;pregnantpeoplex27;WatchvideoMomentmaleGOPRhodeIslandsenatorandcopslapsfemalerivalduringprotestWatchvideoDismemberedWWIINydestroyerisdiscoveredontheseafloor.WatchvideoBorisJohnsonandJustinTrudeaudiscusssizesofeachotherx27;saeroplanesWatchvideoManfightswithtwosecurityguardsatBristolAirport,afterpushingparterWatchvideoGrinningBorisJohnsonsharesbriefhandshakewithPrinceCharlesinRwandaWatchvideoPaulMcCartneyinvitesDeGrohionsteduringGlastonburyfestivalWatchvideoManjumpsfromwindowandcrashestotheground,asheischasedbytwowomen.DM.later('bundle',function(){DM.molFeCarousel.init('#mwv-carousel_e11fc6aa-85c3-4ba1-8929-baedc','channelCarousel',{"peCount":"4","peSize":3,"onPos":0,"nested":true,"updateStyleOnHover":true});});Moroccanpoliceaccusedof'brutality'asofficerisfilmedusinghisbatontostrikewoundedmigrantlyinghelplessonthegroundsurroundedbybodies-asdeathtollrisesto37after2,000stormedfencetoenterSpanishencleAtleast37AfricanmigrantswerekilledtryingtoentertheEUaftercrowdcrushesandallegedpolicebrutality,NGOWalkingBordershasclaimed.Morethan2,000youngmengatheredyesterdaytoscaletheborderwallatMelilla,theEU'sonlylandcrossingontheAfricancontinent.Moroccanofficialswhoguardthecheckpointclaimedmanywerekilledinthecrush,withothersseriouslyinjuredfallingfromthefence.WalkingBordersspokeswoman HelenaMalenotweetedlastnightthat37werekilled-withthedeathtoll'notfinal'.WARNING:GRAPHICCONTENT26comments4videos64sharesCopsaccusedof'brutality'asMoroccodeathtollhits37'Iamfilledwiththankfulnessforeachofyou!'DianaRoss,78,closesGlastonburywithbacktobackhitsShekickedoffhersetwith1980classicI'mComingOutdrawingrapturousapplauseduringherSundayteatimelegendsslotonthefinaldayofGlastonbury.1.1kcomments7videos4.9ksharesDianaRoss,78,closesGlastonburywithbacktobackhitsThemastermindbehindSirPaulMcCartney'svirtualduetwithJohn:AsfanspraisetheGlastonburyperformance,FEMAILrevealshowdirectorPeterJacksonengineereditbyusing'customAI'to'isolateLennon'svocals'Thesinger-songwriter,whomadehistoryastheoldesteversolostartoheadlinetheWorthyFarmmusicfestival,tooktothe covetedPyramidSteforacrowdofthousands.245comments7videos34sharesBeatlesfanbehindGlastonbury'sLennonandPaulMcCartneyduetCoureousorcrazy?4WDattempts notoriousrivercrossingevenasmanygiantcrocodilesblockthepathTerrifyingfootehasresurfacedofa4WDmakingatreacherousjourneyoveranotoriousrivercrossingsurroundedbyatleasthalfadozencrocodilesinoutbackAustralia.ThevideofilmedatCahillsCrossingatKakaduintheNorthernTerritorywasoriginallypostedonTikTokalmosttwoyearsoisstilldoingtheroundsonsocialmediawithmorethan1.4millionviews.Theviralclipshowsthedriverchancingtheirluckbyploughingacrossthesubmergedcrossingappearingunfazedbyuptosixsaltwatercrocodilesblockingthepath.291comments63shares4WDdrivesthroughCahillsCrossinginKakadusurroundedbycrocs  TOPSPORTSTORIESManchesterUnited'rejectBarcelona'sSTUNNINGattempttolureHarryMuiretotheNouCampaspartofaFrenkiedeJongswapdeal Arsenal'COMPLETE£45msigningofGabrielJesusafterfinalisingpersonaltermsonafive-yeardeal'andnowManCitywillgoafterKalvinPhillips  EriktenH'mayheonly£100Mtospendthissummerbeforesales'withManUniteddeterminedto'oidoverpayingfortheirtargets' 'Itwasneveraboutsixmonths':LosAngelesFCarehopefulofkeepingGarethBalebeyondtheWorldCupaspartofa'long-termpartnership'  EoinMorgan'couldQUITasEngland'swhite-ballcaptain'amidpoorformwiththe35-year-oldscoringjustonefifty...asJosButtlerishislikelysuccessor  ChristianEriksenwilldecidehisfuture'inthecominghoursordaysashe'ssettotalktohisent'asManUnitedand'hopeful'Brentfordwaittosee FormerEnglandstarLutherBurrellwillmeetwithRFUchiefsinabidtoeradicateracisminthesportaftertheyrespondedtohisshockingrevelations EmmaRaducanuinsistsshedoesnotmindbeingunderthespotlightonWimbledonCentreCourtdebut,andplanstofeedoffthecrowd TennissensationEmmaRaducanuwillbewatchedbymillionswhenshereturnstoWimbledontomakeCentreCourtdebuttoday TysonFuryrampsuphiswarofwordswithJakePaulashegetshundredsoffanstocallhima'p***y'aheadofhisbrotherTommy'sfightwiththeYouTuber  BernardoSilva'offeredhimselftoBarcelonachiefswhentheywereinManchestertosealFerranTorres'Januarymove'andeven'TEXTEDthem'   DM.later('bundle',function(){ varexpireDate=newDate(), cName=null; if(nigator.userent.search("Silk")>-1){ varcName="KindleExpiry", link="amznapps/android?asin=B00ARI9CDQ", messe='AnimportantmessefromMailOnline.'+ 'MailOnlineonKindleishere!'+ 'WethinkourKindleappisamuchbetterwayofviewingMailOnline.'+ 'ailableFREEintheAmazonAppStore.'+ 'Downloaditnow!'; }elseif(nigator.userent.search("Android")>-1){ if(nigator.userent.search("Mobile")>-1){ varcName="AndroidExpiry", link="play.google.com/store/apps/details?id=com.dailymail.online", messe='WethinkourAndroidappisamuchbetterwayofviewingMailOnline.It\'sFREEintheGooglePlaystoreandhasover2milliondownloads.Getitnow!'; expireDate.setMonth(expireDate.getMonth()+1); }else{ varcName="AndroidExpiry", link="play.google.com/store/apps/details?id=com.dailymail.online",messe="WethinkourAndroidtabletappisamuchbetterwayofviewingMailOnline.ailableforFREEonGooglePlay.Downloaditnow!"; expireDate.setMonth(expireDate.getMonth()+1); } } varlog; functionsetCookie(){ DM.setCookie(cName,cName,expireDate,"/"); } functiongetCookie(){ returnDM.getCookie(cName); } if(cName&&!getCookie()){ varconf=confirm(messe); if(conf){ setCookie(); window.location=link; }else{ setCookie(); } } }); adverts.addToArray({type:'728x90',pos:'leader_bottom'}); ArgosElectronicdealsSeonLaptops,TVs&morefromArgosTUIHolidayDiscountDealsailablefor2021/2022holidaysJDSportsDealsoneverythingDealsonsportswear,footwear&sportsequipmentadidasSewithadidasSemoneyonoutletandfull-priceordersRiverIslandSenowGetdiscountsanddealsonwomensfashionandaccessoriesAo.comAo.comdealsFindgreatdealsonelectricalsDM.later('bundle',function(){DM.has('content','shareLinks',{isChannel:true,'anchor':'tl'});DM.has('content','emailLightbox',{captchaKey:"6LeY2-4SAAAAAIBDImssm1PBXuabVBZBFd0Uin2d"});});window.FFF=window.FFF||{};window.FFF.env={"fffHubHost":"/femail/fashionfinder/index.html","showFFFHubRelatedBanners":true,"name":"production","croppedImesPath":"i.dailymail.co.uk/i/fffhub","timeToReEnableSeButtonsInMilliseconds":,"currency":{"defaults":{"gbpToAud":1.8864}},"facebookAppId":0395,"fffHost":"fff.dailymail.co.uk","priceGroups":[{"value":"","g":0,"label":"Choosepricerange"},{"value":"££££","g":,"label":"500+(££££)"},{"value":"£££","g":370,"label":"250-500(£££)"},{"value":"££","g":160,"label":"75-250(££)"},{"value":"£","g":35,"label":"0-75(£)"}],"doNotUseTransloaditCroppingService":false,"fffVip":"httpfff-vip.hsk.mol.dmgt.net","accessoriseNativeAdUrl":"fff.dailymail.co.uk/accessorise_ad","beAppVersion":"2.0.0","previewHostNames":"live-us.andweb.dmgt.net,live-uk.andweb.dmgt.net,live-us.mol.dmgt.net,live-uk.mol.dmgt.net,mol-uk.andweb.dmgt.net,mol-us.andweb.dmgt.net,fff-vip.hsk.mol.dmgt.net,fff.mol.dmgt.net","platform":"default","doNotUploadProductImesToAkamai":false};BacktotopHomeU.K.NewsSportsU.S.ShowbizAustraliaFemailHealthScienceMoneyVideoTrelShopDailyMailTVSitemapArchiveVideoArchiveTopicsIndexMobileAppsScreenserRSSText-basedsiteReaderPrintsOurPapersTopofpeDailyMailMailon SundayThisisMoneyMetroJobsiteMailTrelZoopla.co.ukPrimeLocationPublishedbyAssociatedNewspapersLtdPartoftheDailyMail,TheMailonSunday&MetroMediaGroupdmgmediaContactusHowtocomplainLeadershipTeamAdvertisewithusContributorsWorkwithUsTermsDonotsellmyinfoCAPrivacyNoticeAboutMailOnlinePrivacypolicy&cookiesAdvertisementAdvertisementDM.later('bundle',function(){if(typeofDM!=="undefined"&&typeofDM.Fn!=="undefined"){DM.Fn.init();}});   

Posto:Home | Daily Mail Onlinerapporto

In caso di violazione del sito, fare clic su Segnalarapporto

Informazioni consigliate

Sito consigliato